SecReT4
Protein ID: 27228621
T4SS name [ID]Tra_F [591]
Gene symboltrhK
Locus tagD786_p124
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]131598..132638 [+]
Productputative transfer protein
Component typeTraK_F
UniProt IDQ8GHS0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 7.3e-52, Aligned region: 91..327
Protein Sequence: 346 a.a.     [Download]
>gi|27228621|ref|NP_758671.1| putative transfer protein [Pseudomonas resinovorans]
MSLPVSLHFFKPAALVLAMAAALPAIAQDQIQIPGMNMPVAASVQPHVVAKPVATPESVPERQEEPQTEK
KQRLVAVTPGSAENPSVPASVMKKPVPAQPIESRQDVVVSSGTNTLIPISRGQMNRIVTPFDVPKVQTVS
TADISVSGNVLYVTTFEDKPVTMYVTPDDDETVAISLTLLPQGVPPIQANLILAKNVQGLASGLPVTSST
NYSGQARKWERSQPYMDTLRSLMREMALGKLPRGYSFGALTNGNKIPACAQPSLSFDFSKSQLIEGHDFK
VFVATAENVSARTVEFDHASCTHPHRAAVSAWPDEVLEPGQKTEVFVITRVPTEVPQSSTRPSLLQ
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|27228492|ref|NC_004444.1|:131598-132638 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGTCACTTCCAGTTTCCCTCCATTTTTTCAAGCCAGCTGCGCTGGTACTGGCTATGGCGGCTGCACTGC
CAGCTATTGCCCAGGATCAGATTCAGATACCAGGCATGAACATGCCAGTTGCTGCCAGCGTGCAGCCTCA
TGTGGTTGCCAAGCCTGTCGCTACTCCAGAGAGCGTCCCGGAACGACAGGAGGAGCCTCAGACGGAAAAG
AAGCAACGTCTGGTCGCCGTCACTCCGGGGTCTGCTGAAAACCCCAGCGTGCCGGCCAGCGTTATGAAGA
AGCCTGTGCCAGCGCAGCCTATCGAGTCCCGCCAAGACGTGGTTGTTTCGAGCGGCACCAATACCCTGAT
TCCGATCAGCCGTGGCCAAATGAACCGTATCGTCACGCCGTTCGATGTACCTAAAGTCCAGACAGTGAGC
ACGGCCGACATTTCGGTAAGCGGTAACGTTCTTTACGTCACAACTTTCGAAGATAAGCCGGTGACTATGT
ACGTCACGCCGGACGACGATGAGACCGTAGCAATCTCCCTGACCTTATTGCCGCAGGGCGTTCCCCCCAT
CCAAGCAAACCTGATTCTGGCGAAAAATGTGCAAGGCCTTGCGAGCGGCTTGCCAGTCACTTCGTCTACG
AACTACAGCGGCCAGGCCCGGAAGTGGGAACGCTCTCAGCCGTACATGGACACGCTTCGCTCCCTGATGC
GCGAAATGGCGCTGGGCAAGCTACCACGTGGATACAGCTTCGGTGCTCTTACGAACGGCAACAAGATCCC
TGCCTGCGCGCAACCAAGCCTCAGCTTCGATTTCAGCAAGTCGCAGCTGATCGAAGGTCATGACTTCAAA
GTTTTCGTGGCCACGGCGGAGAACGTGTCGGCCAGGACTGTCGAGTTCGATCACGCCTCTTGCACTCACC
CTCATCGAGCGGCTGTAAGCGCATGGCCAGATGAGGTGCTTGAGCCTGGCCAGAAAACAGAGGTGTTTGT
AATCACTCGGGTTCCGACCGAAGTGCCGCAAAGCTCCACCCGCCCAAGCCTGTTGCAGTAA
 Primer design