SecReT4
Protein ID: 27228622
T4SS name [ID]Tra_F [591]
Gene symboltrhB
Locus tagD786_p130
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]132651..133967 [+]
Productputative pilus assembly protein
Component typeTraB_F
UniProt IDQ8GHR9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.1e-46, Aligned region: 215..423
Protein Sequence: 438 a.a.     [Download]
>gi|27228622|ref|NP_758672.1| putative pilus assembly protein [Pseudomonas resinovorans]
MKAIQQFLEKLTPRGKLMLAIGGTVLIVGTVVGVAMNAATPERKSRAAAKPQVEAILTDEDPRALGMDSI
ASQLRQLQAQQNRLERTMGQKEKDVQLKNTQEKVSGLEQELQLVQKELAKVGREKKGTGESEDNSSDSSA
SNQARSPIPPRESVFVNKATSSPAELTDVYSNLPPEQPEDPKSRSSEKTEAPKIRVIKAKEDEGKSDKPE
ELSVTLPAGSILSSVLVTGMDAPTGKQAQRDPFPSLVRIKNEAILPNRFRADFRECFMIASGWGDLSSER
AYMRAERLSCVRNDGSVLEASIEAYATGEDGKAGLRGRLVSKQGQIIARSLGAGFLQGIAGAFNVQKVPT
INVTRASDDGKTVAPVYEQAFDSNALQSAGFSGAGSALERIADFYLEMAESIFPVIEIDAMREVDFIVNK
GMTVKFNATTLKVNDVNQ
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|27228492|ref|NC_004444.1|:132651-133967 Pseudomonas resinovorans plasmid pCAR1, complete sequence
GTGAAAGCCATTCAGCAATTCCTCGAAAAACTCACGCCGAGGGGCAAGCTCATGCTTGCCATCGGTGGGA
CGGTTCTGATCGTCGGTACTGTCGTTGGCGTGGCCATGAACGCAGCAACTCCCGAGCGTAAGTCACGCGC
AGCGGCAAAGCCACAGGTCGAGGCCATCCTCACCGACGAAGATCCTCGTGCGCTGGGCATGGACTCCATT
GCGAGCCAACTTCGACAGCTCCAGGCGCAGCAAAACCGCCTTGAGCGGACGATGGGGCAGAAAGAAAAAG
ACGTTCAACTCAAAAACACGCAAGAAAAAGTGAGCGGCTTGGAGCAAGAACTCCAGCTGGTTCAGAAAGA
GTTGGCGAAGGTTGGACGCGAAAAGAAGGGCACCGGTGAGAGTGAGGATAACTCGTCCGACAGCTCCGCC
TCCAACCAGGCACGATCCCCTATCCCACCTCGCGAATCGGTATTCGTCAACAAGGCAACGAGCTCGCCGG
CAGAGCTGACAGACGTTTACTCGAACTTGCCTCCAGAGCAACCGGAAGACCCAAAGTCGCGATCCAGCGA
GAAAACGGAAGCGCCGAAGATCCGGGTGATCAAGGCGAAGGAAGATGAGGGAAAGAGCGATAAGCCAGAG
GAGCTTTCTGTGACGCTGCCCGCGGGTTCGATTTTGTCGAGTGTCTTGGTCACAGGCATGGATGCGCCGA
CAGGGAAGCAGGCACAGCGTGACCCCTTTCCAAGCCTCGTCCGTATCAAGAATGAAGCAATTCTCCCCAA
CCGCTTCAGAGCGGATTTCCGTGAGTGTTTCATGATCGCTAGTGGGTGGGGGGATCTCAGTTCTGAACGG
GCCTATATGCGTGCCGAACGTTTGTCGTGCGTTCGCAATGACGGCTCGGTACTTGAAGCAAGCATTGAGG
CGTATGCGACAGGTGAGGACGGTAAAGCAGGCTTGCGCGGCCGACTGGTAAGCAAACAAGGGCAAATCAT
CGCTCGAAGCTTGGGAGCGGGTTTTCTCCAAGGTATAGCTGGGGCTTTTAACGTCCAAAAGGTACCGACA
ATCAACGTAACTCGAGCTAGTGATGACGGCAAGACAGTAGCTCCAGTATACGAGCAGGCATTCGATAGCA
ACGCGCTTCAGTCAGCCGGATTCAGCGGTGCTGGCTCAGCCCTTGAGCGGATAGCTGACTTCTACTTGGA
AATGGCGGAAAGCATTTTCCCAGTTATTGAAATCGACGCAATGCGTGAAGTCGACTTCATTGTTAATAAA
GGCATGACCGTCAAGTTCAACGCAACCACTCTTAAAGTCAATGACGTTAATCAGTAA
 Primer design