SecReT4
Protein ID: 27228623
T4SS name [ID]Tra_F [591]
Gene symboltrhV
Locus tagD786_p119
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]133978..134478 [+]
Productputative pilus assembly protein
Component typeTraV_F
UniProt IDQ8GHR8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.2e-23, Aligned region: 26..138
Protein Sequence: 166 a.a.     [Download]
>gi|27228623|ref|NP_758673.1| putative pilus assembly protein [Pseudomonas resinovorans]
MIKQLILAIAVAALTSGCTSIMGLGSDEYACKGMPNGVTCMSAKDVYSATEGDDYKTQLKKEQEGGTASS
DKPSTGNATRVLIAEGSDNAPVPMRARNPLPIRSQAVVMRIAIDPWEDEKGDLYVPGFIYTEVEARRWEI
GARNPQPTPTLRPLTVVQPPQAKPAK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|27228492|ref|NC_004444.1|:133978-134478 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGATCAAGCAACTTATCCTGGCGATTGCAGTAGCGGCACTGACTTCTGGTTGCACTAGTATCATGGGTT
TGGGCTCAGACGAATATGCATGTAAAGGCATGCCTAATGGCGTTACCTGCATGTCTGCGAAAGATGTTTA
TTCGGCCACTGAAGGTGATGATTACAAGACCCAGCTTAAAAAAGAACAAGAAGGCGGGACAGCGAGCAGC
GATAAACCATCAACTGGCAATGCTACCCGCGTGCTGATAGCTGAAGGATCAGATAACGCACCGGTGCCTA
TGAGAGCCAGGAATCCGCTTCCTATTCGTTCGCAAGCTGTTGTGATGCGTATTGCCATTGATCCATGGGA
GGACGAGAAAGGCGACCTGTACGTTCCAGGTTTCATTTATACCGAAGTAGAAGCGCGACGCTGGGAGATC
GGCGCTCGAAACCCCCAGCCAACACCAACCTTGCGCCCCCTTACAGTTGTTCAGCCGCCGCAGGCTAAAC
CTGCTAAGTAG
 Primer design