SecReT4
Protein ID: 27228632
T4SS name [ID]Tra_F [591]
Gene symboltrhC
Locus tagD786_p129
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]146294..148759 [+]
Productputative pillus assembly protein
Component typeTraC_F
UniProt IDQ8GHR2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1e-50, Aligned region: 9..254
AAA_10 [PF12846], Evalue: 4.6e-50, Aligned region: 450..729
Protein Sequence: 821 a.a.     [Download]
>gi|27228632|ref|NP_758682.1| putative pillus assembly protein [Pseudomonas resinovorans]
MLKALIRSTPRLSKLINGLAYEPNLYLFQLEGNRLGFAFLCSPLSGSNGDEGDRLKAGLTVDWPEKTTIQ
FSLICTENINEMKTGFLRLRRAFRESGRTDLPVETQALLEKVTNARADYFSDRTMRPVDSISGVRIREQS
LVVSVTIPIANALPTQTEANAAKELFDGLRTSLDSCNLAAVPLTNDSYREIFSSILNQGPTASWREDPDM
KADTDKPLNEQILDYNRSLDVKKDHLQIGEDCFVKTLSAKRFPDVMWQGDASQYLADILSQRGGIRGNCI
INMTLYFPPQLETKDKLSKRRQWSINQSFGPMVHFVPVLRKTKEAYDTLFEDLDKGLPNVQATMTLVVFG
RNREDLIQAASNAKSHFATQGFSLMEDKFCVLPVFVNSLPMCADPDAMKELFRFKTLSLTQALPLLPIYG
DWKGTGTHVAPFISRNGQPVSFHLFDSDTNYNAMIAAQSGSGKSFATNYLITSYLSIGAKVWVIDVGLSY
LKLSEAYKGDFARFDQESNLCLNPFELIEDYSEEEDVLVGLLSAMAAPTVPLIDFQTAGLKRHLTQCWET
LGKTMIVDSIADSLLADPDPRIQDIGHQLFAFTSKGQYGRFFNGKNNLNFKNPFTVLELEELKGRQHLQQ
VVLLQLIYQIQQDMYLGERDRPKIVIIDEAWSLLSQGNVGEFIEHGYRRFRKYGGSAIVITQGVNDLYQN
KVGQAIAENSAFTLLLGQKAEAIDAIQENKRLPLGEGGYRILKTVKSYKGHYSEIFMLTPRGAGIVRLTV
DPYSILLYSTAPEDVQAIRNYTLTGVPQDEAILRVLRDRGVEYNPDPAEVA
 
Nucleotide Sequence: 2466 bp     [Download]
>gi|27228492|ref|NC_004444.1|:146294-148759 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGCTCAAAGCGCTTATCCGCTCAACACCTCGGCTCTCGAAACTGATCAACGGCCTTGCCTACGAGCCGA
ATCTTTACTTGTTCCAGCTGGAAGGGAACCGCCTAGGATTCGCATTCCTGTGTTCCCCTCTCTCAGGCTC
AAACGGGGATGAAGGCGACCGCCTGAAGGCTGGTTTAACGGTCGACTGGCCTGAGAAGACGACGATCCAG
TTCAGCCTCATTTGCACTGAAAATATCAATGAGATGAAGACGGGATTCCTTCGTCTGCGCCGGGCCTTCC
GTGAATCCGGCCGCACTGACCTTCCCGTAGAAACTCAAGCATTGTTGGAGAAGGTGACAAACGCGCGAGC
CGATTATTTCAGCGACCGCACCATGCGCCCAGTTGATTCAATCTCGGGTGTACGAATTCGTGAGCAGAGT
CTGGTCGTATCCGTAACTATTCCGATCGCCAATGCTTTGCCTACCCAGACAGAAGCGAACGCGGCGAAGG
AGCTTTTCGACGGACTGCGAACCTCGCTGGACAGCTGCAACCTGGCAGCCGTGCCCCTCACCAACGATTC
CTACCGAGAAATTTTCTCCTCCATCCTGAACCAGGGGCCAACAGCATCGTGGCGCGAAGATCCGGACATG
AAAGCGGACACAGACAAGCCCTTGAATGAGCAGATCCTCGACTACAACCGCAGCCTCGACGTGAAGAAAG
ACCACCTTCAGATCGGAGAGGACTGCTTCGTAAAAACGCTCTCGGCCAAGCGCTTTCCTGATGTCATGTG
GCAGGGCGATGCCTCTCAGTATCTCGCTGACATTTTGTCTCAGCGCGGCGGCATCCGGGGCAACTGCATT
ATCAATATGACCCTGTATTTCCCTCCCCAGCTGGAGACAAAGGACAAGCTGTCGAAACGCCGCCAATGGT
CCATCAACCAGAGCTTCGGCCCGATGGTGCATTTCGTTCCCGTTTTACGGAAAACGAAGGAGGCCTATGA
CACGCTGTTTGAAGACCTAGACAAAGGGCTTCCCAACGTACAAGCGACAATGACCCTCGTGGTGTTCGGC
CGGAACCGCGAAGACCTTATTCAGGCGGCATCGAATGCGAAGAGCCACTTTGCTACGCAGGGCTTCAGTC
TCATGGAGGACAAGTTCTGTGTGCTGCCCGTGTTCGTGAACTCCTTGCCGATGTGCGCCGACCCGGATGC
GATGAAGGAGCTGTTCCGGTTCAAAACACTGAGCCTCACCCAAGCACTGCCATTGCTGCCAATCTATGGC
GACTGGAAGGGCACAGGAACTCATGTGGCCCCGTTCATTTCCCGAAACGGTCAGCCGGTCAGCTTCCACC
TCTTTGACTCCGACACCAATTACAACGCAATGATTGCCGCTCAGTCGGGCTCCGGGAAGTCGTTTGCGAC
CAACTATCTCATCACGTCGTATCTGAGTATTGGGGCGAAGGTTTGGGTCATCGATGTGGGCCTCTCCTAC
CTCAAGCTGTCTGAAGCGTACAAGGGCGACTTTGCACGCTTTGACCAGGAGTCGAACCTCTGCCTCAACC
CCTTCGAGCTAATTGAAGACTACAGCGAGGAGGAGGATGTCCTGGTTGGGTTGCTCTCTGCTATGGCTGC
TCCGACCGTACCTCTGATCGACTTCCAAACCGCAGGGCTAAAAAGGCACCTTACACAATGCTGGGAAACG
CTTGGCAAGACGATGATTGTCGACAGCATTGCTGACTCTCTCCTTGCCGACCCAGACCCGCGTATTCAAG
ATATTGGTCATCAGCTCTTCGCATTCACCTCGAAGGGACAGTACGGCCGCTTCTTCAATGGTAAGAACAA
TCTCAACTTCAAGAACCCCTTCACCGTACTCGAGCTTGAGGAACTGAAGGGGCGTCAACACCTTCAGCAA
GTCGTACTCCTTCAGCTCATCTACCAGATCCAGCAGGACATGTACCTTGGTGAGCGTGACCGCCCGAAAA
TCGTGATCATTGACGAAGCCTGGTCGCTTCTCTCCCAGGGCAACGTTGGTGAGTTCATCGAGCACGGTTA
CCGGCGATTCCGGAAATATGGCGGTAGTGCCATCGTCATTACCCAGGGGGTCAACGACCTCTATCAGAAT
AAAGTCGGACAAGCCATCGCTGAAAACTCTGCGTTCACCCTACTGCTAGGACAGAAGGCCGAAGCTATTG
ATGCTATCCAGGAAAACAAGCGCCTGCCGCTGGGTGAGGGCGGGTATCGAATCCTGAAGACTGTTAAGTC
GTACAAAGGGCATTACTCCGAGATATTCATGCTCACCCCCCGCGGTGCCGGCATCGTGCGACTCACGGTG
GACCCATACTCGATCCTCCTCTACTCGACCGCACCCGAAGATGTGCAAGCGATCCGAAATTACACGCTCA
CCGGCGTTCCGCAGGATGAGGCAATTCTGCGCGTGCTCCGTGATCGAGGTGTCGAGTACAACCCTGATCC
GGCGGAAGTCGCGTAA
 Primer design