SecReT4
Protein ID: 27228634
T4SS name [ID]Tra_F [591]
Gene symboltrhW
Locus tagD786_p116
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]149325..150563 [+]
Productputative pilus assembly protein
Component typeTraW_F
UniProt IDQ8GHR0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 2.4e-22, Aligned region: 109..225
Protein Sequence: 412 a.a.     [Download]
>gi|27228634|ref|NP_758684.1| putative pilus assembly protein [Pseudomonas resinovorans]
MVKKQLAMCIGLAFGCTMAIAGDDLGIRKYDIKEFDPVLLEQVREISRNANAARAESGQDDMSWVSEMAE
KAIIQAGDENVQQSDSGLASADGSDREKKHPLGDGNRTLIFVSWSMGATALKDILLSFDGLPGVGIVFRG
IPDGMSMGDAVTKMHLLTQETQSTVSVLLDPLAFQRHSVSAVPTVALEAPNDALIAKAAGSSSVSYIEGA
VKEGKRGDLGTIGSTQEIIEPDLMEVAKQRIAELDTDAMKKRAIARFWDNHKGHPLPPVTESATRLVDPS
VIVPDDILDSQGRVVQKAGRINPLDMMPFDQKLVVIDPTQPWQVALAKREYADHGENLTVTVMATQIPTS
SGWDLFNSVQDSLDAPLYLLPPDMAERFQILRAPSVVTADTENFIVREVAQSAFEEANHEHQ
 
Nucleotide Sequence: 1239 bp     [Download]
>gi|27228492|ref|NC_004444.1|:149325-150563 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGGTGAAAAAGCAATTAGCCATGTGCATTGGGTTGGCTTTTGGCTGCACGATGGCCATCGCCGGCGATG
ACCTTGGCATTCGCAAGTACGACATCAAGGAATTCGATCCTGTGCTCCTGGAGCAGGTTCGGGAAATCAG
CCGAAATGCGAATGCCGCGCGCGCAGAAAGCGGCCAAGATGACATGAGTTGGGTGAGTGAGATGGCTGAA
AAGGCCATCATTCAAGCCGGTGATGAAAATGTTCAGCAGAGCGACTCAGGGCTAGCTAGCGCGGATGGCT
CAGATCGCGAGAAAAAACATCCTCTGGGCGATGGAAATCGCACTCTGATTTTCGTGTCGTGGTCGATGGG
CGCTACCGCCCTCAAAGACATACTGCTGTCTTTTGACGGACTGCCTGGTGTTGGCATCGTTTTTCGAGGC
ATACCTGATGGTATGTCGATGGGCGATGCTGTGACCAAAATGCACCTTCTCACGCAAGAGACGCAAAGCA
CTGTAAGCGTTCTGCTTGACCCTCTCGCATTCCAACGTCACAGCGTTTCAGCCGTCCCCACCGTGGCTCT
CGAAGCACCGAATGATGCTCTGATCGCTAAAGCTGCTGGGTCGTCTTCTGTCAGCTATATCGAGGGAGCG
GTTAAGGAGGGGAAGCGGGGGGATTTAGGCACTATTGGCTCCACACAGGAAATCATAGAGCCAGACCTCA
TGGAGGTTGCGAAACAGCGCATTGCAGAGCTGGACACCGACGCCATGAAAAAGCGAGCAATCGCCCGGTT
TTGGGATAACCACAAAGGGCATCCATTGCCGCCGGTAACTGAGAGTGCCACCCGCCTCGTCGACCCATCG
GTCATTGTCCCCGATGACATCCTCGATAGCCAAGGCAGGGTCGTTCAAAAGGCCGGAAGGATTAATCCAC
TCGACATGATGCCGTTTGACCAGAAACTGGTAGTAATCGATCCGACGCAGCCTTGGCAGGTTGCCCTGGC
GAAGCGTGAATACGCAGACCACGGGGAAAATCTGACCGTCACGGTAATGGCTACTCAGATTCCCACTTCC
TCTGGTTGGGATCTGTTCAACAGCGTACAGGACAGCCTGGATGCGCCCCTCTACCTATTGCCGCCTGACA
TGGCGGAGCGCTTCCAGATCCTTCGCGCACCTTCTGTCGTAACAGCCGACACAGAAAACTTCATCGTCCG
CGAGGTTGCTCAATCAGCCTTCGAGGAGGCCAATCATGAGCATCAATAA
 Primer design