SecReT4
Protein ID: 27228635
T4SS name [ID]Tra_F [591]
Gene symboltrhU
Locus tagD786_p120
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]150550..151602 [+]
Productputative pilus assembly protein
Component typeTraU_F
UniProt IDQ8GHQ9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.5e-66, Aligned region: 46..348
Protein Sequence: 350 a.a.     [Download]
>gi|27228635|ref|NP_758685.1| putative pilus assembly protein [Pseudomonas resinovorans]
MSINKVIAAALLMIAGMFSLPGIAADTASSGEVMCEDSGLFGPKLFTDICWACLFPIRVSGVQITPGTAP
AKATKMVFCICQEGSSSIYKPGIITAMWEPARMVETVRKPGCSPTLGGVTLPLGNKRSYGRLRQDNSTQT
GQAAGSFYHAHLYAFPLLQILDLYTPTKCNPDGYLDLDIISFTEIDPTWNNGTLAFFQHPESAAVANPIA
IAACAAESALVTARKEPLESLWWCTGTWGSIYPFAGVTVAQDANRTTALLAARVIAQQHRRGLARRTMGD
ENVCKAGIYPTIPKSQYKVTQFWPKSQNSRAMWLGEPPQTWEGGPSRHVPGTGNDAMYMFWRWTDCCSKL
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|27228492|ref|NC_004444.1|:150550-151602 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGAGCATCAATAAGGTAATAGCCGCCGCACTTCTGATGATTGCAGGTATGTTTTCCCTGCCAGGGATAG
CGGCTGATACGGCTTCGTCCGGTGAGGTGATGTGTGAGGACTCTGGCCTTTTTGGTCCGAAGTTGTTCAC
CGACATCTGCTGGGCGTGCCTTTTCCCAATCCGTGTATCTGGTGTGCAAATAACCCCCGGCACAGCACCC
GCCAAGGCTACAAAAATGGTCTTCTGTATCTGCCAGGAAGGCTCGTCCTCGATCTACAAGCCAGGAATCA
TCACTGCTATGTGGGAGCCGGCCCGGATGGTTGAAACTGTCCGCAAGCCTGGTTGCTCGCCAACCCTAGG
CGGTGTGACGCTCCCGCTTGGCAACAAGCGCAGCTATGGTCGGCTTCGGCAGGACAATAGTACCCAGACA
GGACAGGCCGCCGGTTCGTTCTACCACGCTCACCTGTATGCCTTCCCGCTGCTTCAGATCCTCGATCTCT
ACACGCCTACCAAATGCAATCCGGACGGTTATCTCGACCTCGATATCATCTCGTTCACTGAGATCGACCC
GACCTGGAACAACGGTACGTTGGCGTTCTTCCAGCACCCCGAGTCCGCGGCAGTGGCAAACCCAATCGCT
ATTGCGGCATGTGCTGCCGAATCCGCGTTGGTTACCGCACGAAAGGAACCTCTTGAGTCGCTTTGGTGGT
GTACAGGTACATGGGGGAGTATCTATCCATTTGCCGGCGTAACCGTGGCGCAAGATGCAAACCGGACGAC
AGCATTGCTGGCTGCGCGAGTGATCGCTCAGCAACACCGCAGGGGCCTCGCTCGACGCACTATGGGTGAT
GAAAACGTGTGCAAGGCGGGTATCTACCCGACGATTCCGAAAAGCCAGTACAAAGTGACCCAGTTCTGGC
CAAAGTCGCAGAACAGCAGAGCAATGTGGCTCGGAGAACCGCCGCAGACTTGGGAGGGTGGGCCTAGTCG
GCATGTTCCAGGTACTGGGAACGATGCCATGTACATGTTCTGGCGATGGACAGATTGCTGCTCGAAGCTC
TAA
 Primer design