SecReT4
Protein ID: 27228640
T4SS name [ID]Tra_F [591]
Gene symboltrhF
Locus tagD786_p128
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]155897..156922 [+]
Productputative pilus assemble protein
Component typeTraF_F
UniProt IDQ8GHQ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.5e-64, Aligned region: 46..276
Protein Sequence: 341 a.a.     [Download]
>gi|27228640|ref|NP_758690.1| putative pilus assemble protein [Pseudomonas resinovorans]
MTPLNFPILLLAAAISSTSLAGETKPTESKTPQVGGSSFYQDKERGWFWYEDPPPEQEPEKLEPAPVPAA
PPQAEREASEPAAPELPPTGSVAWIREMLPKLRDAAMDNPTKENVSAYFWANRIMMDKAERFSRRSADVI
RNDPLLDEDMRYPASNAASDALATAAGKQKETLLKLIAGSSALMFFYNGNDCILCEQAQAAVSALEFRYG
FTVMPVSMDGAPLPGGKYPNTQYDTGLAEQLGIITSPALALVIPPNDVKIVSFSTVSMETATTRILMAAN
EAGLISDQEYNATSRLNTMGLIDATKLADAPPDATKNPNEFVNRMRDEARRAFQKDNGGAQ
 
Nucleotide Sequence: 1026 bp     [Download]
>gi|27228492|ref|NC_004444.1|:155897-156922 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGACGCCCCTAAATTTTCCCATCTTGTTGCTTGCTGCCGCTATAAGCAGCACATCCCTTGCGGGAGAGA
CCAAGCCCACCGAGTCGAAAACGCCACAGGTTGGTGGTTCTTCGTTCTACCAGGACAAAGAGCGCGGTTG
GTTCTGGTACGAAGATCCGCCTCCTGAACAGGAACCCGAAAAACTCGAGCCCGCGCCGGTTCCAGCGGCC
CCACCTCAAGCCGAAAGGGAAGCCTCCGAACCAGCCGCGCCCGAGCTGCCCCCGACCGGCAGCGTGGCGT
GGATTCGGGAGATGCTTCCGAAACTGCGTGACGCAGCAATGGATAACCCTACCAAAGAGAACGTGAGTGC
ATATTTTTGGGCCAACCGAATCATGATGGACAAGGCCGAGCGATTCTCACGCCGCTCAGCTGACGTAATC
CGAAATGATCCACTGCTCGATGAGGACATGCGTTATCCGGCTTCCAACGCCGCCTCAGATGCTTTGGCAA
CTGCGGCCGGCAAGCAGAAAGAAACCCTGTTGAAGCTCATCGCTGGCAGCTCTGCGCTGATGTTCTTCTA
CAACGGTAACGACTGCATTCTGTGCGAACAGGCCCAGGCAGCGGTCTCTGCTCTCGAGTTTAGGTACGGG
TTTACTGTCATGCCCGTCTCGATGGATGGGGCCCCCCTTCCTGGCGGCAAATACCCAAACACACAGTACG
ACACTGGGCTCGCAGAGCAGCTGGGCATCATCACCTCGCCTGCGCTGGCCCTAGTCATCCCTCCGAATGA
CGTGAAGATCGTCAGCTTCAGCACCGTCTCAATGGAGACGGCAACCACTCGGATTTTAATGGCAGCGAAT
GAAGCAGGGCTGATTTCCGATCAGGAATACAACGCTACATCCCGCCTTAACACCATGGGTTTGATCGACG
CCACGAAACTGGCTGACGCACCGCCCGACGCAACAAAAAACCCTAACGAATTCGTGAATCGGATGCGCGA
TGAAGCTCGTCGCGCCTTTCAAAAAGACAACGGAGGTGCCCAGTGA
 Primer design