SecReT4
Protein ID: 27228641
T4SS name [ID]Tra_F [591]
Gene symboltrhH
Locus tagD786_p126
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]156919..158319 [+]
Productputative pilus assembly protein
Component typeTraH_F
UniProt IDQ8GHQ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2.2e-94, Aligned region: 26..388
Protein Sequence: 466 a.a.     [Download]
>gi|27228641|ref|NP_758691.1| putative pilus assembly protein [Pseudomonas resinovorans]
MKIKPIALAVALMVPFGAHANIQQQVNEMFSGMINVTSPGAYKTATRGVITGGSVVLRNRISTANLISIT
PPSAKGGCGGINLYSGSFSFINGEEFVALMRNVASNAAGIVSGFAFELALDAMDAQTGGVIRNLANKIQA
LNQMFSNSCQLASGLVTNAKKAYEESTDFKSAMTAFGSNVSSDFFTAKSTKEDSPANRIAASGKAVQCEN
TGNVLWCAMMKSGLQSQILFGSDENAEFIMSMVGSYNVSLTNDASGGKNFAAHPMPKLITGEGLKILVEG
STNLDVKVYQCDQDDPDCSEPNIRTLTSFKGLETRILEDLQNNGILERFANGTATAADGNRIAYLASSRV
GVNLMKITQKAGAQSGYDYLNQFAKKIAADASMSLIYQLLGHTEKGLTSLNMADAGKVIEDLRATKGELM
DEYRSYIEDAMQGKDADGQAEKMLQMAPVFDSGTLPQGTINDNAGA
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|27228492|ref|NC_004444.1|:156919-158319 Pseudomonas resinovorans plasmid pCAR1, complete sequence
GTGAAAATCAAACCGATCGCCCTTGCTGTAGCGCTGATGGTGCCCTTCGGGGCTCACGCGAACATTCAAC
AGCAGGTCAATGAAATGTTCAGCGGCATGATCAACGTCACCAGTCCAGGGGCATATAAAACAGCCACACG
CGGCGTTATTACCGGCGGGTCCGTTGTCCTTCGGAATCGGATATCCACTGCCAACCTCATCAGCATTACC
CCGCCAAGCGCAAAGGGTGGATGCGGGGGGATCAACCTTTACAGCGGCTCGTTCTCCTTTATCAACGGCG
AAGAGTTTGTAGCGCTCATGAGGAATGTGGCGTCGAACGCGGCTGGCATTGTTTCGGGCTTTGCCTTTGA
GTTGGCCCTCGATGCGATGGACGCTCAGACAGGTGGTGTGATCCGCAACCTGGCCAACAAGATCCAGGCG
CTCAATCAAATGTTTTCCAACAGCTGCCAGCTGGCGAGTGGGTTGGTTACGAATGCCAAAAAGGCATACG
AAGAAAGCACCGACTTCAAATCCGCGATGACGGCCTTCGGGTCGAACGTCTCATCTGACTTCTTTACCGC
GAAATCCACCAAAGAAGACTCACCAGCCAACCGGATTGCTGCCTCTGGTAAGGCCGTTCAATGTGAGAAC
ACAGGGAACGTTCTGTGGTGCGCCATGATGAAGTCTGGCCTCCAGTCGCAGATCCTATTCGGCAGCGACG
AAAACGCGGAATTCATCATGTCGATGGTCGGCAGCTACAACGTGTCGCTCACCAACGACGCCAGCGGGGG
GAAAAACTTCGCTGCGCATCCCATGCCGAAGCTGATCACCGGCGAAGGTCTGAAGATTCTGGTTGAGGGC
TCAACCAATCTCGATGTCAAGGTCTACCAGTGCGACCAGGATGACCCTGACTGCTCAGAACCGAACATCC
GCACTCTCACCAGCTTCAAGGGCCTCGAAACCCGAATCCTTGAGGATCTTCAAAACAATGGAATCCTTGA
GCGTTTTGCCAACGGCACTGCAACCGCTGCTGACGGAAACCGGATTGCATACCTCGCATCAAGCCGCGTA
GGGGTGAATCTGATGAAGATCACCCAGAAGGCAGGGGCGCAATCCGGTTATGACTACCTGAATCAGTTCG
CCAAGAAAATTGCTGCTGATGCATCGATGAGCCTGATCTACCAGCTGCTTGGGCACACAGAGAAGGGCCT
GACCAGCCTAAACATGGCGGACGCAGGGAAGGTGATCGAGGATCTGCGGGCTACAAAGGGTGAGCTCATG
GACGAATACCGCTCGTACATCGAGGACGCAATGCAGGGCAAAGATGCCGATGGCCAAGCAGAAAAAATGC
TCCAGATGGCCCCTGTGTTTGATAGCGGAACTCTGCCACAGGGAACCATCAACGATAACGCAGGCGCGTA
A
 Primer design