SecReT4
Protein ID: 27228642
T4SS name [ID]Tra_F [591]
Gene symboltrhG
Locus tagD786_p127
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]158331..161546 [+]
Productputative pilus assembly protein
Component typeTraG_F
UniProt IDQ8GHQ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 9e-104, Aligned region: 4..474
Protein Sequence: 1071 a.a.     [Download]
>gi|27228642|ref|NP_758692.1| putative pilus assembly protein [Pseudomonas resinovorans]
MDFTIYTTGSAEFLEIMLNACAMITGSGDAEDLARIGALIGLFLLAFQAVFNNQAITFGKAGLVLVLYMM
FYGPTATTVIEDTVSSQVRVVDNVPLGPAFVGSVISTVAYGITKTTEQAFSTPSMTDYGLFSSLSTLSKV
RDALRNPMALDGFQNYRKSDGWDLPRSVNEYMTFCSLNPVALRTDKTLTDLYRSPGWAQVLSNQTSSMFI
YVYDGTAGTMKSCAEARSFLNAHLQNVYTDVLEDILQKGFSEEVKTNRMTTGIQVQAATDQAIQSLALSS
KSAQDYVLTSLIAPIFNDSRVDAMNHWQEQRAAMALRESLNQQEIQWAGKGDSFKHYMRPMIAFFEGMLY
AMTPFLAFALLLGGPGLSILGKYLVLPLAVGLWMPLLSIVNAFTLWYAGSQMEAVFNGYDPTGSGFAMLQ
LMDIDKAIGKALGIGGLLAASVPPLALFIVSGSAMVANSIMSQMTAGEKFKSEDVNPRSQESAPVLSTNA
SFTSDQVGAGVAKTGSPQLAETISSEQAASAVVQSASMASQTATSQYQESLKAAGQQLNSSATGRQALAQ
IGENLSAGSVLSSNASYNEAKESLRSLGLSESSLNQATSNAAMGISTPLGGMKRSDNTSADTMTQESKAK
AEKALAQLTQSVQATDSSTLTFATGDAFSSSALAQQSASNTDEIGKTRSSALQAQQTYSQASAQQDSIKA
GQSLNLRDAGVKALTRGLGRNETALALEKMAGQTESGKDLYKQAFGSQSIQDMSKDTSERRAMAAIRAIN
QDGRLGDLLMSQYNPFDFNVNQGDANSNAGLTSSAAKATAGTDAIAGKLDAKWNSNAGAYANSNDMNASG
YQATKEDGATVIGQRNSENMQPVIDANSQNQDHVDNRSSQAAYDTLAARGQAASQGTNLGNIVANGANAA
FTGINTIAGAFRSGSDSEKLENYYDIGIKQGLKPEEAQYFAAKATGEFGSAEGDAYRELNGYYRSQGIRD
DNYIAGAITAIDDAAKAPESGSYPTLTALADSRDAVQYQAYQGPSNEDVPQVPTPATAPQPARSAPPPAP
SPSSAGATNHKPQRPTGINAD
 
Nucleotide Sequence: 3216 bp     [Download]
>gi|27228492|ref|NC_004444.1|:158331-161546 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGGACTTCACTATCTACACCACAGGCAGCGCCGAGTTCCTTGAGATCATGCTCAATGCCTGCGCAATGA
TCACAGGCAGCGGTGACGCAGAAGATCTTGCCCGTATTGGCGCGCTGATAGGTCTTTTTCTGTTGGCTTT
CCAAGCAGTTTTTAATAACCAGGCCATTACCTTCGGAAAGGCGGGCCTTGTGCTCGTCCTTTACATGATG
TTCTACGGGCCTACAGCCACCACTGTTATCGAGGATACGGTGTCGTCGCAGGTGCGGGTGGTGGACAACG
TGCCTCTTGGCCCTGCCTTTGTCGGCTCAGTCATCTCAACGGTGGCCTACGGCATCACCAAAACCACGGA
GCAAGCGTTCTCTACTCCGAGCATGACCGACTATGGGCTGTTCTCGAGTCTGAGTACGTTGTCGAAGGTG
CGCGATGCTCTTCGGAACCCGATGGCACTGGACGGTTTTCAAAACTACCGAAAGTCTGATGGGTGGGATC
TGCCCCGATCGGTAAACGAGTACATGACATTCTGTTCGCTAAACCCTGTCGCGCTGAGAACGGATAAGAC
CCTGACTGACTTGTACCGTTCTCCCGGCTGGGCTCAGGTGCTCTCAAATCAGACATCATCGATGTTCATC
TATGTCTACGACGGTACCGCCGGCACCATGAAGAGCTGTGCAGAGGCCAGGTCGTTTCTCAACGCGCATT
TGCAAAACGTCTACACAGACGTGCTGGAGGACATTCTTCAGAAAGGATTCAGCGAAGAAGTCAAAACCAA
TCGAATGACCACCGGTATACAGGTTCAAGCTGCTACAGACCAGGCAATTCAAAGTCTGGCACTCAGTAGC
AAGTCGGCTCAGGACTACGTTTTGACTTCGCTAATAGCCCCGATTTTTAACGACTCTCGTGTCGACGCCA
TGAACCATTGGCAAGAACAAAGGGCTGCAATGGCTCTCCGTGAATCGCTCAACCAGCAAGAAATTCAATG
GGCGGGGAAGGGCGACAGCTTCAAGCATTACATGAGGCCGATGATCGCCTTCTTCGAGGGCATGCTCTAT
GCGATGACGCCGTTCTTGGCCTTTGCTCTACTCCTGGGTGGGCCTGGCCTTTCTATCCTCGGCAAGTATC
TCGTGTTGCCGTTGGCCGTTGGGTTGTGGATGCCGCTGTTAAGTATCGTCAATGCTTTTACCCTCTGGTA
TGCCGGTTCCCAGATGGAGGCCGTATTCAATGGATACGATCCGACTGGATCTGGTTTTGCAATGCTTCAA
CTCATGGACATTGATAAGGCGATCGGCAAGGCTCTCGGTATCGGCGGCTTGCTCGCCGCTTCTGTGCCGC
CTTTGGCTCTTTTCATCGTTTCTGGCTCAGCCATGGTTGCGAATAGCATCATGAGCCAAATGACAGCTGG
CGAAAAATTCAAGTCCGAAGACGTGAATCCTCGATCTCAGGAGAGCGCACCTGTTCTAAGTACCAATGCT
TCGTTCACTTCTGACCAGGTAGGGGCCGGCGTTGCTAAAACAGGTAGCCCGCAACTGGCAGAAACCATCA
GCAGCGAACAAGCAGCAAGCGCTGTTGTGCAGAGCGCGAGCATGGCATCTCAAACGGCAACCTCTCAGTA
CCAAGAAAGCCTCAAGGCAGCTGGTCAACAACTCAACTCATCGGCCACAGGGCGGCAAGCACTTGCGCAG
ATCGGCGAAAACCTTTCGGCAGGTTCGGTCCTCAGTTCGAATGCATCTTACAACGAGGCAAAAGAGTCCC
TGCGGAGCCTCGGCCTATCCGAGTCTTCGCTGAATCAGGCCACGTCCAACGCCGCAATGGGTATTTCTAC
GCCGCTTGGCGGCATGAAGCGGTCGGATAACACCTCGGCCGACACCATGACTCAGGAAAGCAAAGCCAAG
GCGGAGAAAGCACTTGCCCAACTTACGCAGTCTGTCCAGGCAACCGATTCGAGCACATTGACCTTCGCGA
CGGGCGATGCCTTCTCAAGTAGCGCGTTGGCACAGCAGAGCGCATCGAACACAGACGAGATCGGGAAAAC
CCGTTCGAGCGCCCTTCAGGCGCAACAGACCTATAGCCAGGCATCTGCGCAACAAGATTCGATCAAGGCC
GGTCAATCACTTAACCTTAGAGACGCCGGCGTCAAAGCGCTCACTCGCGGTCTCGGCCGCAATGAAACCG
CGCTGGCGCTCGAGAAAATGGCAGGACAAACAGAGTCAGGTAAAGATCTGTACAAACAAGCCTTCGGTAG
CCAGAGCATCCAGGATATGTCGAAAGACACGAGCGAGCGTCGAGCGATGGCAGCGATTCGTGCGATCAAT
CAGGACGGACGCCTTGGTGATCTGTTGATGAGTCAATACAACCCGTTCGATTTTAACGTCAACCAAGGAG
ATGCAAACTCGAACGCTGGTCTCACAAGCAGTGCCGCCAAGGCCACTGCCGGCACCGACGCCATCGCTGG
CAAGCTTGATGCAAAATGGAATTCAAATGCTGGGGCCTATGCAAACTCAAATGACATGAATGCCAGTGGC
TATCAAGCTACGAAGGAGGATGGCGCTACGGTTATTGGGCAGCGAAATTCTGAGAACATGCAGCCAGTGA
TTGATGCTAATTCGCAGAATCAGGATCACGTGGATAACCGTTCCTCCCAAGCTGCATATGACACCCTGGC
AGCAAGGGGGCAAGCTGCAAGCCAAGGTACGAATCTGGGCAACATTGTAGCTAATGGCGCGAATGCGGCC
TTTACAGGGATCAATACGATTGCTGGAGCCTTCCGCAGCGGCTCCGATAGTGAAAAGCTCGAAAACTATT
ACGACATCGGTATCAAACAAGGGTTGAAGCCCGAGGAAGCACAATACTTTGCCGCCAAGGCTACTGGTGA
GTTTGGATCGGCCGAGGGTGATGCCTATCGAGAGCTGAATGGTTACTATCGTAGCCAAGGCATCCGGGAT
GATAACTACATCGCAGGGGCTATTACTGCGATCGATGATGCTGCCAAGGCCCCTGAAAGCGGTTCCTATC
CCACCCTGACGGCGCTGGCGGATTCAAGGGATGCCGTGCAGTACCAGGCGTACCAGGGCCCTTCGAATGA
GGATGTTCCTCAAGTTCCAACACCGGCTACAGCCCCACAACCAGCCAGATCCGCTCCGCCACCTGCACCG
TCGCCATCCTCGGCGGGAGCCACAAACCACAAACCTCAGCGACCGACAGGGATCAACGCTGACTAG
 Primer design