SecReT4
Protein ID: 27228645
T4SS name [ID]Tra_F [591]
Gene symbol-
Locus tagD786_p111
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]163134..163703 [-]
Producthypothetical protein
Component typeOrf169_F
UniProt IDQ8GHP9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 189 a.a.     [Download]
>gi|27228645|ref|NP_758695.1| hypothetical protein D786_p111 [Pseudomonas resinovorans]
MFNIRASSFVAVYACIAIFNSASANANGFSLKGTMWERASMATACKPDPLLLYSLALNESKTSAGQGMVA
PHPFALRNAPSGALYPKTYMAAKVVLGKYIAEDILTDIGIMQINYRWNGNRVASPELLLDPEVNIRIGAQ
ILCESIAQYPVDMQLAIGGYHTRNPKRELDAREYASNVLRIWRSLQRLK
 
Nucleotide Sequence: 570 bp     [Download]
>gi|27228492|ref|NC_004444.1|:c163703-163134 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGTTTAATATCCGTGCCAGCTCCTTTGTTGCTGTCTATGCATGCATTGCAATATTTAATTCAGCAAGCG
CAAACGCTAATGGATTTTCATTAAAAGGGACAATGTGGGAGCGAGCCTCAATGGCCACCGCATGCAAACC
GGACCCATTGCTTCTATATTCACTGGCCCTGAATGAATCTAAAACTTCTGCCGGACAAGGGATGGTTGCA
CCACACCCATTTGCGCTTCGGAACGCGCCTAGTGGTGCCCTGTACCCTAAAACCTATATGGCTGCCAAGG
TTGTACTCGGCAAATATATTGCCGAAGACATTCTTACCGATATAGGGATTATGCAAATAAATTATCGCTG
GAATGGCAATCGAGTAGCAAGCCCAGAGCTTCTTCTTGACCCTGAAGTAAACATTCGGATCGGTGCCCAG
ATACTTTGCGAGTCGATTGCGCAATACCCTGTCGATATGCAACTAGCCATCGGTGGCTACCATACACGAA
ACCCAAAACGTGAACTTGACGCACGTGAGTATGCGAGTAATGTGCTCAGAATTTGGCGTTCACTACAGCG
TTTAAAGTAA
 Primer design