SecReT4
Protein ID: 27367058
T4SS name [ID]Tra_F [519]
Gene symboltraL
Locus tagVV2_0632
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T4SS(s) in this replicon]
Location [Strand]683196..683498 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDQ8D6A4
KEGG IDvvu:VV2_0632
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 7.5e-31, Aligned region: 7..99
Protein Sequence: 100 a.a.     [Download]
>gi|27367058|ref|NP_762585.1| type IV conjugative transfer system protein TraL [Vibrio vulnificus CMCP6]
MDNQQLFFAIPKHLSKGKRISGLPRDEVLPGFLLFVLFFLAGKYLIGLIFAAIWFIGLRYIKVQYGENII
ALTLYWWGNTSLNHSVFKHTPAAQKRYWLS
 
Nucleotide Sequence: 303 bp     [Download]
>gi|326424156|ref|NC_004460.2|:683196-683498 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGGACAACCAACAGCTTTTTTTTGCTATCCCAAAACACCTCAGCAAAGGCAAGCGCATATCAGGTTTAC
CCCGAGACGAAGTCTTGCCCGGGTTTCTTCTCTTTGTGCTCTTCTTCTTAGCCGGTAAATACTTGATAGG
CCTTATCTTTGCAGCCATTTGGTTTATAGGACTTCGGTATATCAAAGTTCAGTACGGTGAAAACATCATC
GCCTTAACCCTCTACTGGTGGGGGAACACCTCACTCAATCACAGTGTCTTCAAACACACTCCCGCAGCGC
AAAAGCGTTACTGGCTCTCTTAA
 Primer design