SecReT4
Protein ID: 27367072
T4SS name [ID]Tra_F [519]
Gene symboltraF
Locus tagVV2_0646
StrainVibrio vulnificus CMCP6
Repliconchromosome II [GenBank: NC_004460] [Browse all T4SS(s) in this replicon]
Location [Strand]694343..695167 [+]
Producttype-F conjugative transfer system pilin assembly protein TraF
Component typeTraF_F
UniProt IDQ8D690
KEGG IDvvu:VV2_0646
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.7e-65, Aligned region: 46..263
Protein Sequence: 274 a.a.     [Download]
>gi|27367072|ref|NP_762599.1| type-F conjugative transfer system pilin assembly protein TraF [Vibrio vulnificus CMCP6]
MGNSPYVKEAMMKYRHKTKLAWLLTLFTWALSNTQISFANPSPPKGWKWYNEPKDLPSSPKPVPTPLPSN
TKTTVMSATQQMQWFHQTYEEVKADATIHPDDEQKYLKLMQLNHFIGEKTAQTGMTFKKLLLKYPEYSYV
KDRPVEQAARSTYHQQERQKKIDMVEKMKNEGWGFFFVYEGDDPLTQSLAPSMQQFADRYKLELLGVSND
GVFIDNIRQNRLNNDKVVVPFTPALILVNPTTSEFKPLAYGFISQNDLLGRFYNVATNYQSPDF
 
Nucleotide Sequence: 825 bp     [Download]
>gi|326424156|ref|NC_004460.2|:694343-695167 Vibrio vulnificus CMCP6 chromosome II, complete sequence
ATGGGCAATAGTCCATACGTAAAGGAAGCGATGATGAAATACCGACATAAGACAAAATTAGCATGGCTAC
TGACACTGTTTACCTGGGCGTTAAGTAACACCCAGATAAGTTTTGCCAACCCTTCCCCCCCGAAAGGCTG
GAAATGGTATAACGAGCCCAAAGACCTTCCATCCTCACCAAAACCAGTGCCCACACCCCTACCTTCAAAT
ACGAAGACTACCGTGATGAGCGCCACTCAGCAGATGCAGTGGTTTCATCAGACTTATGAGGAGGTAAAGG
CGGATGCCACCATTCACCCCGATGATGAACAGAAATATCTCAAACTGATGCAGCTCAATCACTTCATTGG
TGAGAAGACGGCCCAAACAGGCATGACGTTTAAAAAACTGCTACTCAAGTATCCAGAGTACTCCTACGTC
AAAGATCGCCCTGTGGAGCAAGCCGCGAGAAGTACCTATCACCAACAAGAGCGCCAAAAGAAAATCGATA
TGGTGGAGAAGATGAAAAACGAAGGTTGGGGCTTTTTCTTTGTCTATGAAGGTGACGATCCGCTCACTCA
GAGTCTGGCTCCCTCAATGCAGCAATTTGCCGATAGGTACAAGCTTGAACTGCTCGGCGTGAGTAATGAC
GGCGTGTTTATCGACAACATCCGTCAAAATCGCCTCAATAATGACAAAGTTGTCGTGCCGTTTACCCCAG
CCCTGATCTTGGTCAATCCAACCACCTCAGAGTTTAAACCCCTCGCTTACGGGTTTATTTCACAAAACGA
TTTGTTGGGACGGTTCTATAACGTCGCGACCAATTACCAATCCCCTGACTTTTAA
 Primer design