SecReT4
Protein ID: 27375154
T4SS name [ID]Trb [242]
Gene symboltraG
Locus tagbll0043
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]37305..39332 [-]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ89YB1
KEGG IDbja:bll0043
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.8e-102, Aligned region: 126..577
TraG-D_C [PF12696], Evalue: 9.2e-31, Aligned region: 416..537
TrwB_AAD_bind [PF10412], Evalue: 1.9e-29, Aligned region: 186..551
AAA_10 [PF12846], Evalue: 9.7e-07, Aligned region: 182..493
Protein Sequence: 675 a.a.     [Download]
>gi|27375154|ref|NP_766683.1| traG gene product [Bradyrhizobium japonicum USDA 110]
MSDPSNHRRQERAAAMSATKILWGQVIMVFGIVLLTIWAATEWTAWRLGFQPQLGQPWFELLHFPFYLPP
AFFWWWYAYDAYAPSIFTEGAFIAASGGIIAAAVAIGMSVWRAREAKNAETYGSARWAKAKEIEQAGLLG
PDGVVLGRFERTYLRHDGPEHVLCFAPTRSGKGVGLVIPSLLTWPGSAIVHDLKGENWQLTAGFRARHGR
VLLFDPTNAKSSAYNPLLEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAEE
DKTLAGVAAFLSDPKRPIETTLAAMMRTAHLGEAGVHPVVASAARELLNKSGNERSGVLSTAMSFLGLYR
DPVVAEVTRCCDWRITDIVGGERATTLYLVVPPSDINRTKPLIRLILNQIGRRLTEDLQAKAGRRRLLLM
LDEFPALGRLDFFESALAFMAGYGIKSFLIAQSLNQIEKAYGPNNSILDNCHVRVSFATNDERTAKRVSD
ALGTATEMKAMKNYAGSRLAPWLGHLMVSRSETARPLLTPGEMMQLPPSDEIVMMSGLHPIRAKKARYYE
DRRFQERIMAPPMLTKSNGGRLDDWSSRPLPPRPRALETLNDDQTDDEDPKAADRRQQPELDRDTVENKE
PLENEFASDLVDELDEDVPRIRRMNDMMQGVARQASLDPGDDLGL
 
Nucleotide Sequence: 2028 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c39332-37305 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
GTGAGTGATCCTTCCAATCACCGACGTCAGGAGAGGGCGGCCGCCATGTCGGCGACCAAGATTCTTTGGG
GGCAGGTCATCATGGTCTTCGGCATCGTCCTGCTCACGATCTGGGCCGCGACGGAATGGACGGCTTGGCG
CCTCGGCTTTCAGCCGCAGCTCGGGCAGCCCTGGTTCGAGCTGCTCCATTTTCCGTTCTACCTTCCGCCT
GCCTTCTTCTGGTGGTGGTATGCCTACGATGCTTACGCGCCCTCAATCTTCACCGAGGGCGCCTTCATCG
CGGCATCCGGCGGCATCATCGCTGCGGCGGTCGCGATCGGTATGTCGGTCTGGCGCGCCCGCGAAGCGAA
GAATGCCGAGACTTATGGGTCCGCGCGGTGGGCGAAGGCAAAGGAGATCGAGCAGGCTGGATTGCTTGGA
CCCGACGGCGTGGTGCTCGGCCGGTTCGAGCGCACCTATCTTCGCCATGATGGACCGGAGCATGTCCTGT
GCTTCGCACCCACGCGATCGGGCAAGGGCGTCGGCCTCGTCATCCCTTCGCTCTTGACGTGGCCGGGCTC
GGCTATCGTCCACGACCTCAAGGGGGAGAACTGGCAGCTCACTGCCGGCTTTCGCGCCCGACACGGCCGT
GTCCTTCTGTTCGATCCGACCAACGCGAAGTCGTCGGCCTATAACCCGTTGCTCGAGGTGCGCCGCGGCG
AGTGGGAGGTGCGCGACGTCCAGAACATTGCCGACATTCTGGTCGACCCGGAGGGCAGCCTCGAGAAGCG
GAACCATTGGGAGAAAACCAGTCACGCCCTGCTGGTCGGCGCGATCCTCCACGTCCTCTATGCCGAGGAA
GACAAGACGCTCGCCGGTGTCGCAGCCTTCTTGTCCGATCCCAAGCGGCCCATTGAGACGACGCTTGCCG
CAATGATGCGAACCGCGCATCTCGGCGAGGCCGGTGTTCATCCCGTCGTCGCGTCCGCTGCCCGCGAGTT
GCTGAACAAGTCCGGCAACGAACGCTCCGGTGTCTTGAGCACCGCCATGTCGTTCCTGGGCCTTTACCGA
GATCCCGTGGTGGCGGAGGTGACGCGGTGCTGCGACTGGCGGATTACCGATATCGTTGGCGGAGAGCGAG
CGACCACGCTGTACCTTGTCGTGCCGCCCTCCGACATCAATCGCACCAAGCCGCTGATCCGTCTGATCCT
CAACCAGATAGGCCGCCGCTTGACCGAGGATCTGCAAGCCAAGGCCGGCCGGCGCCGGCTCCTCCTGATG
CTCGACGAATTCCCGGCGCTCGGCCGGCTCGACTTCTTCGAGTCTGCGCTGGCCTTCATGGCCGGATACG
GCATCAAGAGTTTCCTGATTGCTCAGTCGCTGAACCAGATCGAGAAGGCCTACGGGCCCAACAACTCGAT
CCTTGACAACTGCCACGTCCGGGTCAGCTTTGCGACCAACGACGAGCGCACCGCAAAGCGCGTGAGCGAC
GCGCTCGGCACGGCGACCGAGATGAAGGCGATGAAGAACTATGCCGGCAGCCGGCTGGCGCCTTGGCTGG
GCCACCTCATGGTGTCGCGGTCCGAGACCGCCCGCCCGCTGCTCACGCCCGGCGAGATGATGCAGCTCCC
GCCCTCCGACGAGATCGTCATGATGTCGGGCCTCCATCCGATTCGGGCGAAGAAGGCGCGCTATTACGAA
GATAGACGTTTCCAGGAGCGCATCATGGCGCCGCCGATGCTGACGAAATCCAATGGCGGCCGGTTGGACG
ATTGGAGCTCAAGGCCATTGCCGCCGCGCCCAAGGGCATTGGAGACGTTGAACGACGACCAGACGGATGA
CGAAGATCCAAAGGCCGCCGACCGCAGGCAGCAGCCGGAACTCGATCGAGACACGGTGGAGAATAAGGAA
CCACTCGAGAACGAGTTCGCTTCGGACCTCGTGGATGAGCTCGATGAAGATGTCCCGCGGATCAGGCGCA
TGAACGACATGATGCAGGGCGTGGCGCGCCAAGCCTCCCTCGATCCCGGCGACGATCTCGGATTGTGA
 Primer design