SecReT4
Protein ID: 27375156
T4SS name [ID]Trb [242]
Gene symbol-
Locus tagbll0045
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]41537..42445 [-]
Producttransglycosylase
Component typeTrbN
UniProt IDQ89YA9
KEGG IDbja:bll0045
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 302 a.a.     [Download]
>gi|27375156|ref|NP_766685.1| unnamed protein product [Bradyrhizobium japonicum USDA 110]
MQDPVARAANQAHQRSTPLFGEKPSHNSGPRNRRAAATHSGGQTGGPCAPPVGSKTPRHDGGDRASLAVL
LLTGLLVIGGPTAAVSGQRAPARSQPASDHYASHVAEAAQRFGIPAAWIRAVMRVESNGDRRAVSPKGAL
GLMQLMPKTWADMRARYGLGRDPFDPRDNILAGAAFLRELHDRYGSPGFLAAYNAGPGRYEEFRDRHRPL
PAETTAYVAAIVPFVDAEGAPGPLLLAASSRSSWTRAPLFFDHADGPSPGARAALDQPAHGGSVGTTVHD
ISAIAPQSEGLFVALSAMGRSQ
 
Nucleotide Sequence: 909 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c42445-41537 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGCAGGATCCTGTCGCGCGTGCCGCCAACCAGGCGCATCAACGGTCCACCCCCTTGTTCGGGGAAAAGC
CCTCTCATAACTCGGGTCCACGCAACCGTCGGGCGGCCGCCACGCACAGCGGCGGTCAAACCGGTGGTCC
GTGCGCACCGCCGGTAGGCAGCAAGACGCCTCGCCATGATGGCGGAGACAGGGCGAGCCTTGCCGTTCTC
CTCCTTACCGGCCTGCTGGTGATTGGCGGGCCAACGGCAGCAGTGTCCGGGCAGAGAGCACCGGCACGAA
GTCAACCGGCGAGCGATCACTACGCATCTCATGTGGCAGAGGCCGCGCAGCGCTTTGGCATTCCGGCTGC
ATGGATACGAGCCGTCATGCGGGTCGAGAGCAATGGCGATCGGCGTGCCGTCTCACCCAAAGGCGCACTC
GGCCTGATGCAACTCATGCCCAAGACTTGGGCGGACATGCGCGCGCGCTATGGTCTCGGGCGCGATCCCT
TCGATCCCCGTGACAACATCCTCGCCGGCGCCGCCTTTCTTCGCGAACTGCACGACCGTTACGGCTCGCC
GGGCTTTCTCGCGGCCTATAATGCAGGTCCCGGCCGCTACGAGGAGTTTCGGGATAGACACCGTCCACTG
CCCGCGGAGACGACAGCCTATGTCGCGGCCATCGTCCCTTTTGTCGACGCGGAGGGAGCGCCAGGACCTC
TTCTCCTCGCGGCTTCTTCTCGTTCATCCTGGACGCGGGCGCCGCTGTTCTTCGACCACGCTGACGGGCC
GTCCCCTGGCGCGCGAGCGGCGCTCGATCAACCCGCGCACGGCGGCTCAGTCGGCACTACGGTGCACGAT
ATTTCGGCGATTGCGCCGCAGTCGGAGGGCCTGTTCGTCGCGCTCTCGGCCATGGGGCGATCGCAATGA
 Primer design