SecReT4
Protein ID: 27375158
T4SS name [ID]Trb [242]
Gene symboltraF
Locus tagbll0047
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]42820..43365 [-]
Productconjugal transfer protein
Component typeTraF
UniProt IDQ89YA7
KEGG IDbja:bll0047
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 5.2e-51, Aligned region: 29..166
Protein Sequence: 181 a.a.     [Download]
>gi|27375158|ref|NP_766687.1| traF gene product [Bradyrhizobium japonicum USDA 110]
MTRFGYLMLTYLAALVAGALALVHPAPRLIWNATASTPIGLYALHPLGELRDLELVAVRLPEPIASFLAD
GGFLPKGLPLLKRVMALPGQTVCRSGDAITVDAVDVGAAHEHDHRGRPLPRWSGCHTLEPGEVFLMNPTV
PDSLDGRYFGALPVSSIVARAVPLWTDEAADGRFVWRAATH
 
Nucleotide Sequence: 546 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c43365-42820 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGACCCGCTTCGGCTATCTCATGTTGACCTACCTTGCGGCGCTGGTCGCCGGCGCCCTGGCCCTCGTTC
ATCCTGCGCCGCGGCTGATTTGGAACGCTACCGCGAGCACGCCAATAGGGCTCTACGCGCTGCATCCGCT
CGGAGAGCTGCGCGACTTGGAACTGGTCGCGGTACGGCTGCCGGAACCGATCGCCAGCTTCCTTGCCGAT
GGCGGCTTTCTTCCAAAAGGTCTGCCGCTGCTGAAGCGTGTGATGGCGCTGCCCGGGCAAACCGTGTGCC
GGTCGGGCGATGCCATCACGGTCGATGCTGTCGATGTCGGCGCCGCACACGAGCACGATCATCGCGGCCG
TCCGCTGCCGCGTTGGAGCGGTTGCCATACCCTCGAACCGGGCGAGGTCTTTCTCATGAACCCGACCGTC
CCAGACAGCCTGGACGGCCGCTATTTCGGCGCGCTCCCCGTCAGCTCGATCGTCGCGCGCGCAGTCCCGC
TTTGGACGGACGAAGCCGCCGACGGCCGTTTCGTCTGGCGCGCCGCCACTCATTGA
 Primer design