SecReT4
Protein ID: 27383390
T4SS name [ID]Trb [242]
Gene symboltrbI
Locus tagbll8279
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]9068090..9069292 [-]
Productconjugal transfer protein
Component typeTrbI
UniProt IDQ89B86
KEGG IDbja:bll8279
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.2e-66, Aligned region: 212..391
Protein Sequence: 400 a.a.     [Download]
>gi|27383390|ref|NP_774919.1| trbI gene product [Bradyrhizobium japonicum USDA 110]
MAIDSEDERQGDIPPVAPPDLRLRGERPRVTRLSRKVLVGLGALSALAVAGALGYALQTGNKAQSGQELL
STQNRPSAEGLAGLPKDYTGLPRQAPPLGPPLPGDLGKPILNTGAAPNTMAATSDPETQRRGQEIEAARV
SRLFAQTAQQPQSVGQLIPNASAGATATPAATPPVDAGSAQNMQDRKTAFLTAPTDKRTVSPERLEAKAS
PYVVQAGTVIPAALITGIRSDLPGQVTAQVTEAVWDSPSGKYLLIPQGAKLIGQYDSSVAFGQSRILLVW
TRIIMPDGNSIVLERQPGADTGGYAGLEDEVDNHWGMLFKAAVLSTMLSVGGEAGTSQNENNLVQAIRSG
ASNSISQTGQQIVQRQLNIQPTLTIRPGFPVRVIVTRDLVLAPYRQEASR
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c9069292-9068090 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGGCGATAGACAGCGAAGACGAACGTCAGGGCGACATTCCGCCCGTCGCGCCGCCGGACCTGCGGCTCC
GAGGCGAGCGGCCCCGTGTCACACGGCTCTCGCGCAAGGTCCTTGTCGGCCTCGGCGCGCTGTCTGCCCT
CGCGGTCGCGGGCGCGCTCGGCTACGCGCTCCAGACCGGCAACAAGGCGCAGAGCGGCCAAGAACTGCTC
AGCACCCAGAACCGGCCTTCGGCCGAGGGTCTGGCCGGGTTGCCGAAAGACTATACCGGCCTGCCGCGTC
AAGCACCGCCGCTCGGGCCGCCGCTGCCCGGCGATCTCGGCAAGCCGATCCTCAACACCGGCGCTGCACC
GAACACGATGGCGGCGACGTCAGATCCCGAGACGCAGCGCAGGGGCCAGGAAATCGAGGCGGCGCGGGTC
AGCCGCCTCTTTGCCCAAACTGCTCAGCAACCGCAGAGCGTCGGCCAACTCATCCCGAATGCCTCCGCTG
GCGCCACGGCCACTCCGGCCGCGACACCGCCCGTCGATGCCGGATCTGCCCAGAACATGCAGGACCGCAA
GACGGCCTTCCTCACTGCTCCGACAGACAAGCGCACGGTCAGTCCGGAACGGCTCGAAGCCAAGGCCTCA
CCTTACGTCGTGCAGGCGGGCACCGTGATTCCGGCTGCGCTCATCACGGGCATTCGTTCCGATCTGCCCG
GCCAAGTCACCGCACAGGTGACCGAGGCGGTCTGGGACAGTCCGTCTGGCAAATATCTTCTGATCCCGCA
GGGTGCCAAACTGATAGGTCAGTACGATAGCTCCGTCGCGTTCGGCCAGTCCCGCATCCTCCTGGTCTGG
ACCCGCATCATCATGCCGGATGGCAACTCGATCGTGCTAGAGCGCCAGCCCGGCGCCGACACCGGTGGTT
ATGCCGGTCTCGAGGATGAGGTCGACAACCACTGGGGCATGCTGTTCAAGGCTGCCGTCCTCTCGACCAT
GCTCAGCGTCGGAGGCGAGGCGGGCACGAGCCAGAATGAGAACAACCTCGTTCAAGCGATCCGTAGCGGC
GCGTCCAACAGCATCAGCCAGACCGGCCAGCAGATCGTGCAGCGCCAGCTCAACATCCAGCCGACGCTGA
CCATCCGGCCAGGTTTCCCGGTGCGGGTCATCGTTACGCGGGATTTGGTGTTGGCTCCCTACCGCCAGGA
GGCAAGCCGATGA
 Primer design