SecReT4
Protein ID: 27383391
T4SS name [ID]Trb [242]
Gene symboltrbG
Locus tagbll8280
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]9069283..9070362 [-]
Productconjugal transfer protein
Component typeTrbG
UniProt IDQ89B85
KEGG IDbja:bll8280
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.5e-69, Aligned region: 127..350
Protein Sequence: 359 a.a.     [Download]
>gi|27383391|ref|NP_774920.1| trbG gene product [Bradyrhizobium japonicum USDA 110]
MTPPIFAKAGGPASRFSIVHQNRKDGDTSFRKSALTALLISVSALGGCAHNFIPPDISYDTAEPATLTVD
PAPPVKIVELPQPLPLPGQLKPLAAGKRVPEAADPKVRVKQANAAARVQPVRNGFINAVQVYPFSGGALY
QVYTAPGQITDVALQEGEQLVGSGPVAAGDTVRWIIGDTESGAGATKKIHILVKPTRPDLVTNLVINTDR
RTYLLELCSTEKTYMASVSWQYPEDQLIALRRQNAAAETAAPIAAGVDLASINFRYSIEGDDPAWRPLRA
FDDGNKVYIEFPSGIAQGEMPPLFVIGPAGGSELVNYRANRNYYIVDRLFAAAELRLGDKDSERRVRIVR
TDGRPRAWR
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c9070362-9069283 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGACCCCGCCGATTTTCGCAAAAGCCGGCGGTCCGGCTTCGCGTTTTTCCATCGTTCATCAAAACCGGA
AGGACGGCGATACGTCTTTCCGTAAATCCGCTTTGACGGCTTTGCTGATATCCGTCTCAGCCCTTGGCGG
CTGCGCGCACAATTTCATCCCACCCGACATCAGCTACGACACTGCGGAGCCTGCGACGCTCACCGTCGAC
CCGGCGCCGCCCGTCAAAATCGTGGAGTTGCCCCAGCCGCTGCCACTGCCCGGGCAGTTGAAGCCGCTCG
CCGCCGGCAAACGCGTCCCGGAAGCCGCCGATCCAAAGGTTCGCGTCAAACAGGCCAACGCCGCGGCACG
GGTGCAGCCGGTCCGCAATGGTTTCATCAACGCAGTACAGGTCTATCCGTTCTCCGGCGGAGCCCTCTAC
CAGGTCTACACGGCGCCCGGCCAGATCACAGATGTCGCCCTCCAGGAGGGTGAGCAACTCGTCGGCTCCG
GTCCGGTTGCCGCCGGTGACACTGTGCGCTGGATCATCGGCGATACCGAGAGCGGCGCGGGCGCGACCAA
GAAGATTCATATCCTCGTCAAGCCGACGCGGCCGGATTTGGTCACCAATCTCGTGATCAACACCGATCGG
CGGACCTATCTCCTCGAGCTGTGCTCGACGGAAAAGACCTATATGGCCTCGGTCTCCTGGCAGTATCCCG
AGGACCAGCTGATTGCGCTTCGGCGGCAGAATGCGGCCGCTGAAACTGCGGCGCCAATTGCGGCTGGCGT
CGATCTCGCCTCGATCAACTTCCGCTACTCTATTGAGGGCGACGACCCGGCCTGGCGTCCGCTGCGCGCC
TTTGATGACGGCAACAAGGTCTACATCGAGTTCCCAAGCGGTATCGCCCAGGGTGAAATGCCGCCGCTGT
TCGTGATAGGTCCAGCCGGCGGCTCCGAACTGGTGAACTACCGAGCAAACCGTAACTACTACATCGTCGA
CCGCTTGTTCGCCGCCGCCGAATTGCGTCTTGGCGACAAGGATAGTGAGCGGCGCGTGCGCATCGTCCGC
ACCGACGGAAGGCCGCGCGCATGGCGATAG
 Primer design