SecReT4
Protein ID: 27383392
T4SS name [ID]Trb [242]
Gene symboltrbF
Locus tagbll8281
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]9070359..9071048 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ89B84
KEGG IDbja:bll8281
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.4e-61, Aligned region: 23..226
Protein Sequence: 229 a.a.     [Download]
>gi|27383392|ref|NP_774921.1| trbF gene product [Bradyrhizobium japonicum USDA 110]
MSVFRRSSVRYGRTPEPETPYQRAAQVWDERIGSARVQARNWRLMAFGSLMLSCGLAGGLVWQSTHGTVV
PWVVQVDKLGEAQVMAPATADYRPNDPQIAWYLAHFIQIVRSLPADPIIVRHNWLQAYDFTTTAGAAALN
DYARANDPFANLGKQQVAIDVSSVIRASPDSFRVAWVEHRFQDGALAGTTRWTAILTIAIQPPTDADRLR
KNPLGIYVNAINWSKELGQ
 
Nucleotide Sequence: 690 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c9071048-9070359 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGTCAGTCTTCCGGCGATCGTCGGTTCGTTACGGCCGCACGCCCGAACCAGAAACCCCCTACCAGCGCG
CAGCGCAAGTTTGGGATGAGCGCATTGGATCCGCCCGGGTGCAGGCCAGGAACTGGCGGCTGATGGCCTT
CGGTTCGCTGATGCTGTCCTGCGGCCTTGCCGGTGGACTCGTCTGGCAATCCACGCACGGCACTGTCGTT
CCCTGGGTGGTGCAGGTCGACAAGCTCGGCGAAGCGCAAGTCATGGCGCCCGCTACCGCCGACTACAGGC
CGAACGACCCACAGATCGCCTGGTATCTCGCCCACTTCATTCAGATCGTTCGCTCGCTTCCGGCCGACCC
GATCATCGTGCGGCACAACTGGCTGCAGGCCTATGATTTCACAACCACGGCGGGCGCGGCGGCGCTGAAC
GACTACGCCCGCGCCAACGACCCCTTCGCCAATCTCGGCAAGCAGCAGGTCGCGATCGACGTCTCCAGCG
TCATCCGCGCCTCGCCCGACAGTTTTCGCGTGGCCTGGGTTGAGCACCGCTTTCAGGACGGGGCGCTCGC
CGGCACCACGCGTTGGACCGCGATCCTCACCATCGCGATTCAGCCGCCCACCGACGCCGATCGGCTGCGC
AAGAATCCACTCGGCATCTACGTCAACGCCATCAACTGGTCAAAGGAGCTGGGACAATGA
 Primer design