SecReT4
Protein ID: 27383393
T4SS name [ID]Trb [242]
Gene symboltrbL
Locus tagbll8282
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]9071052..9072413 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ89B83
KEGG IDbja:bll8282
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.5e-55, Aligned region: 37..262
Protein Sequence: 453 a.a.     [Download]
>gi|27383393|ref|NP_774922.1| trbL gene product [Bradyrhizobium japonicum USDA 110]
MNNVGVIDTFLNTFTTYIDSGFGLIKGEVTYLSSTLIVIDITLAGLFWAWGADEDILQRLVKKTLYIGFF
AFIITNFTKLSGIIFNSFAGLGLKAGGSSISTADFLRPGRLAQVGLDAGQPLLDSASQMMGFTSFFSNFV
QIAVLMVSWLLVLIAFFILAVQLFVTLIEFKLTTLAGFILIPFALFNKTAFLAEKVLGNVVASGVKVMVL
AVIVGIGTGLFSQFTTAYAGGQPTIEQALSVVLAALAMLGLGIFGPGIATGLVSGAPQLGAGATVGTGLA
VAGTAMVGGAALGLAGRGAMAASSGAAAAARGGAAMAGGMSSAYSLASAGRSGAGGVASGLGGAGRAAAS
HAAAPVRRAAAQAAGTMTESFTSGARAGVANTGGSSTMGTIRSGAAANDGAASQVPSESGPPAWAQRVKR
NQTVIHGAQTTAQALKSGDSHGGGHSVDLSGGE
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c9072413-9071052 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
GTGAACAACGTCGGCGTCATCGACACCTTTCTCAATACTTTCACGACCTACATTGATTCGGGTTTCGGCC
TGATCAAGGGCGAGGTCACGTATTTGTCGTCGACGTTGATCGTCATCGACATCACGCTCGCGGGCCTGTT
CTGGGCTTGGGGCGCAGACGAAGACATTCTCCAGCGACTGGTGAAGAAGACCCTCTACATCGGCTTCTTT
GCCTTCATCATCACTAACTTCACCAAGCTCTCAGGCATCATCTTCAACAGCTTCGCAGGCCTCGGCCTGA
AGGCCGGCGGCTCGTCGATCTCGACGGCGGACTTCCTGCGGCCCGGCCGGCTTGCGCAGGTCGGCCTCGA
CGCCGGGCAGCCGTTGCTCGACTCCGCAAGCCAAATGATGGGCTTCACCAGCTTCTTTTCCAACTTTGTA
CAAATTGCCGTGCTGATGGTGTCCTGGCTGCTGGTGCTGATCGCCTTCTTCATTCTGGCGGTGCAGCTCT
TCGTCACGCTGATCGAGTTCAAGCTGACGACGCTCGCCGGCTTCATCCTCATTCCGTTCGCGCTCTTCAA
CAAGACCGCCTTTCTCGCGGAGAAGGTGCTGGGCAATGTCGTTGCCTCCGGCGTGAAGGTCATGGTGCTC
GCCGTCATCGTCGGCATCGGCACCGGGCTCTTTTCGCAGTTCACCACCGCCTATGCCGGCGGCCAGCCGA
CGATCGAGCAGGCGCTCTCTGTCGTGCTCGCGGCGCTCGCTATGCTGGGCCTCGGCATCTTCGGGCCCGG
CATCGCGACCGGGCTTGTTTCCGGCGCGCCGCAGCTTGGTGCGGGCGCTACCGTCGGCACGGGTCTGGCT
GTTGCCGGTACAGCGATGGTCGGCGGCGCGGCGCTCGGTTTGGCCGGAAGGGGAGCGATGGCAGCCAGCT
CTGGTGCTGCGGCTGCCGCGCGCGGCGGTGCGGCGATGGCGGGCGGCATGTCCTCCGCCTACAGCCTCGC
ATCAGCCGGTCGGTCCGGCGCCGGCGGCGTCGCGTCCGGTCTCGGCGGTGCAGGCCGTGCGGCGGCTAGT
CACGCGGCAGCTCCCGTCAGACGCGCCGCTGCGCAAGCGGCAGGGACAATGACGGAGAGCTTCACTTCTG
GCGCCCGTGCCGGCGTCGCCAACACGGGTGGCTCCTCGACGATGGGGACCATTCGGAGCGGCGCGGCCGC
AAACGATGGAGCCGCATCTCAAGTGCCGAGCGAGAGCGGTCCGCCCGCCTGGGCCCAACGCGTCAAGCGC
AATCAGACCGTCATTCACGGCGCTCAGACCACCGCGCAAGCCCTCAAATCCGGCGACAGCCATGGCGGCG
GCCACTCCGTCGACCTCTCGGGAGGAGAATAA
 Primer design