SecReT4
Protein ID: 27383395
T4SS name [ID]Trb [242]
Gene symboltrbJ
Locus tagbll8284
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]9072741..9073499 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ89B81
KEGG IDbja:bll8284
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 3.1e-07, Aligned region: 19..54
Protein Sequence: 252 a.a.     [Download]
>gi|27383395|ref|NP_774924.1| trbJ gene product [Bradyrhizobium japonicum USDA 110]
MTALEVRRAGLAAATALSLAFSISPLSTTSVLAQWIVYDPTNFSQNVLTAARELQQINNQIQMLTNQAQS
LVNQGKNLANLPLSTLTQLQSSIAKTQSLLSQAQNIAFNVERVQTMYSSTYGTAAATGSNATMFAAAQSR
WQNSVGAFEDSLKVQAGVVGNISTNSSAMSTLVTASQSASGALQAAQAGNQLLALQSQQLSDLVAVLAAK
GRADALEQARVTATESQGQQQYKIFSTRSGYQPGNVTMFSGN
 
Nucleotide Sequence: 759 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c9073499-9072741 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGACCGCTCTCGAAGTGCGGCGCGCTGGCTTGGCCGCTGCGACGGCTCTCTCGCTCGCCTTTTCGATCT
CGCCGCTTTCGACGACCTCGGTCCTTGCGCAGTGGATCGTCTACGACCCCACCAACTTCAGCCAGAACGT
GCTGACCGCGGCGCGCGAGCTGCAGCAGATCAACAATCAGATCCAGATGCTGACCAATCAGGCCCAAAGC
CTGGTGAATCAGGGAAAGAACCTCGCCAACCTGCCGTTGTCGACGCTGACCCAGCTTCAGTCATCGATTG
CCAAGACCCAGTCACTGCTGAGCCAGGCCCAGAACATCGCCTTCAACGTCGAGCGCGTCCAGACGATGTA
TTCCAGCACCTACGGCACGGCGGCGGCGACGGGCTCCAATGCAACAATGTTTGCCGCGGCTCAAAGTCGT
TGGCAGAACTCGGTGGGCGCTTTCGAAGACTCGCTGAAGGTGCAGGCCGGCGTCGTCGGCAATATCTCGA
CCAACTCCAGCGCAATGAGTACGCTGGTTACCGCCAGTCAGTCGGCAAGTGGCGCTTTGCAAGCCGCTCA
AGCCGGCAACCAACTCCTCGCGCTGCAATCCCAGCAGCTATCCGATCTCGTCGCGGTGCTCGCCGCGAAG
GGACGGGCGGATGCGCTGGAGCAGGCGCGCGTAACGGCGACCGAGTCGCAGGGCCAGCAGCAATACAAAA
TCTTCTCGACACGCAGCGGCTATCAGCCGGGCAACGTCACCATGTTCAGCGGCAACTGA
 Primer design