SecReT4
Protein ID: 27383396
T4SS name [ID]Trb [242]
Gene symboltrbE
Locus tagbll8285
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]9073496..9075934 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ89B80
KEGG IDbja:bll8285
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.6e-35, Aligned region: 442..722
CagE_TrbE_VirB [PF03135], Evalue: 2.8e-11, Aligned region: 182..388
AAA_16 [PF13191], Evalue: 8.8e-05, Aligned region: 443..670
Protein Sequence: 812 a.a.     [Download]
>gi|27383396|ref|NP_774925.1| trbE gene product [Bradyrhizobium japonicum USDA 110]
MLNLAEYRNRPHSLADFLPWAALVEKGVVLNKDGAFQRTARFRGPDLDSATPAELVGVTARLNNALRRLG
SGWAIFVEAQRIAAQTYPHNTFPDAASALVDLERRDAFEEAGAHFESRYFLTFVWLPPAEDASRIEGWLY
EGRAQSGVDPHELLRGFVDRTNRVLQLVEGFMPEVAWLDDGETLTYLHSTISTRQQRVRVPETPMHLDAL
LADEPLAGGLEPRLGNHHLRTLTVVGFPTATYPGILDELNRLAFPYRWSTRAILLDKTEAVKLLTKIRRQ
WFAKRKSIAAIVKEVMTNEASTLVDSDAANKATDADLALQELGTDDVGQAYITATVTVWDEDPGLATEKL
RLVEKVIQGRDFTCMPEGVNALEAWLGSLPGHAYANVRQPPLSTLNLAHLIPLSAVWAGSDRDEHFRSSP
LFFGKTEGSTPFRFSLHVGDVGHTLIVGPTGAGKSVLLALMAIQFRRYRKSQIFAFDFGGSIRTAALAMG
GDWHDLGGSLSNSAEDSVSLQPLARIGDAAERAWAAEWVTAILAKEGVTIDPTVKEHVWSALTSLASSPA
EERTITGLTVLLQSTALKQALQPYCVGGSSGRLLDAEAEQLGFASVQAFETEGLIGAGAAPAVLTYLFHR
IEGRLDGRPTLLIIDEGWLVLDDPAFAQQLREWLKTLRKKNASVVFATQSLSDIDGSNIAPAIVESCPTR
IFLPNERAIEPQITAIYQRFGLNDRQIEIIARATPKRDYYCQSRRGNRLFELGLGPVALAFCAASSKTDH
AAIERLLAEHGRDDFTAAWLADHELLWAADLIPDLTNLEVQS
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c9075934-9073496 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGCTGAACCTCGCCGAATACCGCAACCGGCCCCACAGTCTTGCCGACTTCCTGCCCTGGGCCGCTTTGG
TCGAGAAGGGCGTCGTCCTCAACAAGGACGGCGCGTTCCAGCGCACGGCGCGCTTCCGCGGGCCGGATCT
CGACAGCGCGACGCCTGCCGAACTGGTCGGCGTAACGGCCCGACTCAACAACGCGCTCCGCCGTCTCGGC
TCAGGTTGGGCGATCTTCGTCGAGGCCCAGCGCATCGCCGCCCAGACTTATCCGCACAATACTTTTCCTG
ACGCCGCATCAGCGCTGGTCGATTTGGAGCGGCGGGACGCTTTCGAGGAGGCGGGCGCGCATTTCGAGAG
CCGCTATTTCCTGACCTTCGTCTGGCTCCCGCCGGCTGAGGACGCCTCGCGGATCGAAGGCTGGCTCTAT
GAGGGCCGCGCGCAGAGCGGCGTCGATCCCCACGAGCTGCTGCGTGGTTTTGTTGATCGGACCAACCGCG
TCCTGCAACTTGTCGAAGGGTTCATGCCTGAGGTGGCGTGGCTCGATGATGGCGAGACGCTGACCTACCT
GCATTCGACGATCTCGACCCGGCAACAGCGCGTGCGCGTCCCCGAGACGCCGATGCATCTCGACGCGCTG
CTCGCGGACGAACCGCTTGCCGGTGGCCTCGAGCCGCGGCTCGGCAACCATCATCTTCGTACACTCACGG
TGGTCGGCTTTCCGACCGCGACCTATCCCGGAATCCTCGACGAGCTGAACCGGCTTGCCTTTCCTTACCG
CTGGTCGACCCGCGCGATCCTCCTCGACAAGACCGAGGCGGTGAAACTCTTGACCAAGATCCGCCGGCAG
TGGTTCGCCAAGCGCAAGTCGATTGCAGCCATCGTCAAGGAGGTGATGACCAACGAGGCCTCGACACTGG
TCGATAGCGATGCGGCGAATAAGGCCACTGACGCCGATCTCGCCTTGCAGGAACTGGGCACCGACGACGT
CGGTCAAGCCTACATCACCGCGACCGTCACCGTCTGGGACGAGGACCCCGGTCTCGCCACTGAGAAGCTT
CGCCTCGTCGAGAAGGTGATCCAGGGGCGCGACTTCACCTGCATGCCGGAAGGGGTGAACGCGCTCGAAG
CCTGGCTCGGCTCTCTGCCGGGTCACGCCTACGCCAACGTTCGCCAACCGCCGCTCTCGACACTGAACCT
CGCTCACCTGATTCCGCTTTCAGCGGTCTGGGCCGGGTCAGATCGGGATGAGCATTTCCGCAGCTCCCCG
CTCTTCTTCGGTAAGACCGAAGGCTCGACGCCGTTCCGGTTTTCGCTGCATGTCGGCGACGTCGGCCACA
CCCTGATCGTCGGCCCGACCGGCGCCGGCAAATCCGTGCTGCTGGCGCTGATGGCGATCCAGTTCCGGCG
CTACCGGAAAAGCCAGATCTTCGCCTTCGATTTTGGTGGCTCGATCCGCACGGCGGCCCTTGCCATGGGC
GGCGACTGGCACGACCTCGGCGGAAGTCTGTCCAACAGCGCCGAAGATTCAGTCTCCCTTCAACCCCTCG
CACGTATCGGCGATGCGGCCGAGCGCGCCTGGGCGGCCGAATGGGTGACGGCAATCCTCGCCAAGGAGGG
CGTCACCATCGATCCGACCGTGAAGGAGCACGTCTGGTCGGCATTGACGTCACTGGCGTCCTCACCGGCC
GAGGAACGCACGATCACCGGTTTGACGGTTCTGTTGCAATCGACCGCACTCAAGCAGGCGCTGCAACCTT
ATTGCGTCGGCGGCTCCTCCGGCCGTTTGCTCGACGCGGAGGCCGAGCAGCTCGGCTTTGCGTCGGTGCA
GGCGTTCGAGACCGAGGGCTTGATCGGCGCAGGCGCGGCGCCTGCCGTCCTCACCTACCTCTTCCATCGC
ATCGAGGGCCGGCTCGACGGCCGGCCGACCCTCCTCATCATCGACGAGGGGTGGCTCGTCCTCGACGATC
CAGCCTTCGCGCAACAGCTCAGGGAATGGTTGAAGACCCTGCGGAAGAAGAACGCTTCCGTCGTCTTCGC
CACTCAATCGCTTTCCGACATCGATGGCAGCAACATCGCGCCAGCGATCGTCGAGAGCTGCCCGACGCGG
ATATTCCTGCCGAACGAGCGCGCGATCGAACCGCAGATCACCGCCATCTACCAGCGGTTCGGCTTGAACG
ACCGCCAGATCGAGATCATCGCGCGGGCGACGCCGAAGCGCGACTACTATTGCCAGTCTCGTCGCGGCAA
TCGGCTGTTCGAGCTCGGCCTTGGGCCAGTTGCGCTCGCCTTCTGCGCCGCCTCCTCCAAGACCGACCAT
GCCGCAATCGAACGGCTGCTTGCCGAGCACGGCCGTGACGACTTCACGGCCGCCTGGCTCGCCGATCACG
AACTGCTGTGGGCCGCCGATCTCATCCCTGACCTGACAAACCTGGAGGTGCAATCATGA
 Primer design