SecReT4
Protein ID: 27383397
T4SS name [ID]Trb [242]
Gene symboltrbD
Locus tagbsl8286
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]9075942..9076220 [-]
Productconjugal transfer protein
Component typeTrbD
UniProt IDQ89B79
KEGG IDbja:bsl8286
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3.1e-11, Aligned region: 15..89
Protein Sequence: 92 a.a.     [Download]
>gi|27383397|ref|NP_774926.1| trbD gene product [Bradyrhizobium japonicum USDA 110]
MMAGIIDLDVPGFFAPVHRALTEAILMGGAPRTVAIANGTLAAAIALGLHLWIPGALIWAVGHAAAVWAA
KRDPQFVDVVRRHLRYPSYLGV
 
Nucleotide Sequence: 279 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c9076220-9075942 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
GTGATGGCCGGCATCATCGATCTAGACGTGCCGGGCTTCTTCGCGCCGGTTCATCGCGCGCTCACCGAGG
CAATCCTGATGGGCGGCGCGCCCCGCACGGTTGCGATCGCCAACGGCACGTTGGCCGCGGCAATAGCGCT
CGGCCTCCACCTCTGGATCCCCGGCGCGCTGATTTGGGCCGTGGGCCATGCCGCGGCGGTCTGGGCGGCC
AAGCGCGACCCGCAGTTCGTGGACGTCGTTCGACGCCACCTCCGCTATCCTTCTTACCTCGGCGTGTGA
 Primer design