SecReT4
Protein ID: 27383398
T4SS name [ID]Trb [242]
Gene symboltrbC
Locus tagbll8287
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]9076217..9076558 [-]
Productconjugal transfer protein
Component typeTrbC
UniProt IDQ89B78
KEGG IDbja:bll8287
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8e-23, Aligned region: 14..104
Protein Sequence: 113 a.a.     [Download]
>gi|27383398|ref|NP_774927.1| trbC gene product [Bradyrhizobium japonicum USDA 110]
MIQFPPAIRRVRLRFTGLAAIAVISIAIAPAAYASGSSMPWETPLNQILESVQGPVAKIMSVIIITVTGL
TLAFGDSSGGFRRLIQIVFGLSIAFAASSFFLTFFSFSGGALV
 
Nucleotide Sequence: 342 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c9076558-9076217 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
ATGATCCAGTTTCCTCCCGCGATCCGTCGCGTGCGACTCCGCTTCACGGGCCTCGCCGCAATTGCCGTCA
TCTCCATTGCAATCGCGCCCGCGGCCTACGCCTCCGGCTCGTCGATGCCGTGGGAGACGCCGCTCAATCA
GATCCTGGAGTCGGTGCAAGGGCCGGTCGCGAAGATCATGTCGGTCATCATCATCACCGTGACCGGCCTG
ACGCTTGCGTTCGGCGATAGTTCCGGTGGCTTCCGCCGGCTGATCCAGATTGTCTTCGGTCTGTCGATCG
CCTTCGCCGCGTCGAGCTTCTTCCTGACCTTCTTCAGCTTCTCCGGCGGAGCGCTGGTGTGA
 Primer design