SecReT4
Protein ID: 27383399
T4SS name [ID]Trb [242]
Gene symboltrbB
Locus tagbll8288
StrainBradyrhizobium japonicum USDA 110
Repliconchromosome [GenBank: NC_004463] [Browse all T4SS(s) in this replicon]
Location [Strand]9076555..9077553 [-]
Productconjugal transfer protein
Component typeTrbB
UniProt IDQ89B77
KEGG IDbja:bll8288
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5e-87, Aligned region: 25..290
Protein Sequence: 332 a.a.     [Download]
>gi|27383399|ref|NP_774928.1| trbB gene product [Bradyrhizobium japonicum USDA 110]
MAGTSLHSEAFSRGARMLRTALGPAIATFLEDPSIVEVMLNPDGRLWVDRLSGGLEDSGRTMSAADGERI
VRLVAHHVGAEVHAEKPRVSAELPETGERFEGLLPPVVAAPAFAIRKPAVAVFTLDDYAAAGIMTAGQAG
MLREAVAARKNILVAGGTSTGKTTLTNALLAEIAGTTDRVVLIEDTRELQCRAPNLVALRTKDGVASLSD
LVRSSLRLRPDRIPIGEVRGSEALELLKAWGTGHPGGIGTIHAGTALGALRRLEQLIQEAVLTVPKALIA
ETIDLVAVLRGRGSERRLAELALVAGLDPATGDYRVNSAAAGGPSSLPGDPS
 
Nucleotide Sequence: 999 bp     [Download]
>gi|27375111|ref|NC_004463.1|:c9077553-9076555 Bradyrhizobium japonicum USDA 110 chromosome, complete genome
GTGGCGGGCACTTCACTCCATTCGGAAGCCTTCTCGCGTGGCGCGCGCATGCTGCGCACCGCGCTTGGTC
CCGCGATCGCCACCTTCCTGGAAGACCCCTCGATCGTCGAGGTGATGCTCAACCCCGATGGTCGGCTCTG
GGTCGACCGGCTGTCCGGCGGGCTGGAGGATAGCGGACGAACGATGTCCGCCGCCGACGGCGAGCGGATC
GTGCGCCTGGTCGCGCACCATGTCGGCGCTGAGGTGCATGCCGAAAAGCCCCGCGTCTCGGCCGAGCTTC
CCGAGACGGGGGAGAGGTTCGAGGGGCTTCTCCCGCCTGTCGTTGCGGCGCCGGCCTTTGCGATCCGCAA
GCCTGCGGTGGCTGTTTTCACCCTGGATGACTACGCGGCGGCCGGCATCATGACGGCCGGGCAGGCGGGC
ATGCTCCGCGAAGCCGTCGCGGCCCGCAAGAACATCCTGGTCGCCGGCGGCACGTCGACCGGCAAGACCA
CCCTGACAAACGCGCTGCTGGCGGAGATCGCCGGCACCACCGATCGCGTGGTCCTGATCGAGGACACGCG
TGAACTGCAGTGCCGCGCGCCGAATCTGGTCGCGCTGCGCACCAAGGACGGCGTGGCGTCCCTGTCGGAT
CTGGTTCGGTCTTCCCTCCGCCTACGCCCCGACCGGATTCCGATCGGCGAGGTACGGGGCAGCGAAGCCC
TGGAGCTCCTCAAAGCCTGGGGCACGGGCCACCCCGGTGGGATCGGAACGATTCACGCCGGCACGGCTCT
GGGCGCGCTTCGCCGCCTCGAGCAGCTCATCCAGGAAGCCGTCCTCACTGTTCCCAAGGCGCTGATCGCC
GAGACCATCGATCTCGTCGCGGTTCTGCGCGGCCGCGGCAGCGAACGCCGCCTCGCTGAACTTGCTCTCG
TCGCCGGCCTCGATCCCGCCACCGGCGACTACCGCGTCAACTCTGCCGCGGCGGGCGGCCCATCCTCACT
TCCCGGAGACCCCTCATGA
 Primer design