SecReT4
Protein ID: 27383482
T4SS name [ID]Tra_I [179]
Gene symboltraH
Locus tagpCTX-M3_053
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]34020..34520 [+]
Producthypothetical protein
Component typeTraH_I
UniProt IDQ8GFT2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 166 a.a.     [Download]
>gi|27383482|ref|NP_775012.1| hypothetical protein pCTX-M3_053 [Citrobacter freundii]
MKIKMQTVLAAVSVLALAGCASQSEKEKQISAQQLVDQELREQAIKIKLAQDELYQAGAINRTRYKFPTI
INANSQYVRVSWQGDAYELLEQLAKQRGLQFTSQGIKLPLPLNIDVGGSKVTFEQLLTLIRQQTQYRATI
NQKPGELQLLYLTPSKKGSFLRGTRP
 
Nucleotide Sequence: 501 bp     [Download]
>gi|54145488|ref|NC_004464.2|:34020-34520 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGAAAATCAAAATGCAAACGGTCCTCGCGGCCGTTTCTGTGTTAGCTCTTGCCGGGTGTGCCTCTCAAA
GCGAAAAGGAAAAACAAATCTCTGCACAGCAGCTGGTAGATCAGGAATTGCGTGAGCAAGCCATTAAGAT
AAAACTCGCACAGGATGAGCTTTACCAGGCTGGAGCCATTAACAGGACCCGTTACAAATTCCCTACCATT
ATCAATGCAAACAGTCAGTATGTTCGTGTGAGCTGGCAGGGTGATGCTTACGAATTACTGGAGCAACTGG
CTAAACAGCGTGGCCTTCAATTCACCAGTCAGGGGATTAAGTTACCGCTTCCACTCAATATCGATGTTGG
TGGTTCGAAGGTTACGTTTGAACAGTTGCTGACCCTGATCCGACAACAAACGCAGTACCGTGCCACCATC
AACCAGAAACCCGGTGAACTGCAGCTGCTTTACCTCACACCATCGAAGAAAGGTTCATTCCTCAGAGGGA
CCCGCCCATGA
 Primer design