SecReT4
Protein ID: 27383483
T4SS name [ID]Tra_I [179]
Gene symboltraI
Locus tagpCTX-M3_054
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]34517..35296 [+]
Producthypothetical protein
Component typeTraI_I
UniProt IDQ8GFT1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 259 a.a.     [Download]
>gi|27383483|ref|NP_775013.1| hypothetical protein pCTX-M3_054 [Citrobacter freundii]
MKLKLIVLLTLPLLAANVARADDSDVKGLDYYMDPPSQSDDEADVTGSMLNDAAHTIGFRGGKAERAKEI
RAALENQRSNLDYMYSFQPLISSEGYLPPVIAEAKDVAHITNEQIRTANRAYDIVVPARFVSNPPTWKSY
LLTGLMAQRIELPEPAAMPKDGKQRDIWKKAVALGWSDGRQKADEIFTANFNRLTRDYTGMLRYSTLLQQ
GMIKAPVITQQQQTVTGDKNRLMLGDKTKRMKQQAEFDINKRSWKPTIR
 
Nucleotide Sequence: 780 bp     [Download]
>gi|54145488|ref|NC_004464.2|:34517-35296 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGAAACTTAAACTGATCGTGCTTCTGACGTTACCGCTGCTTGCTGCGAACGTTGCACGCGCGGACGACT
CCGATGTTAAAGGCCTGGATTACTACATGGACCCGCCAAGCCAAAGTGACGATGAGGCCGATGTTACTGG
CAGTATGCTAAACGACGCAGCGCACACCATTGGATTTCGCGGCGGTAAGGCAGAACGCGCTAAAGAAATT
CGCGCCGCGCTGGAAAATCAGCGCAGCAACCTTGATTACATGTATTCGTTCCAGCCGCTGATCTCTTCTG
AAGGCTACCTGCCTCCAGTCATTGCTGAAGCTAAAGACGTTGCACACATTACCAATGAGCAAATCCGAAC
GGCCAACCGTGCCTATGACATTGTGGTGCCGGCGCGCTTTGTCAGTAACCCACCGACATGGAAAAGCTAT
CTTCTGACCGGGCTGATGGCGCAGCGGATCGAATTGCCTGAACCGGCGGCAATGCCGAAGGACGGGAAAC
AACGTGATATCTGGAAAAAAGCTGTCGCGCTGGGCTGGTCTGACGGTCGCCAAAAAGCTGATGAGATATT
CACTGCTAATTTCAATCGCCTCACACGGGATTACACCGGCATGTTGCGCTACAGCACGCTACTGCAGCAG
GGCATGATTAAGGCTCCAGTCATCACACAGCAGCAGCAAACAGTTACAGGGGATAAAAACCGCCTCATGC
TGGGCGATAAAACGAAACGTATGAAGCAGCAAGCTGAGTTTGACATCAACAAACGCAGCTGGAAACCGAC
CATACGTTAA
 Primer design