SecReT4
Protein ID: 27383484
T4SS name [ID]Tra_I [179]
Gene symboltraJ
Locus tagpCTX-M3_055
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]35307..36470 [+]
Producthypothetical protein
Component typeTraJ_I
UniProt IDQ8GFT0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.9e-21, Aligned region: 24..303
Protein Sequence: 387 a.a.     [Download]
>gi|27383484|ref|NP_775014.1| hypothetical protein pCTX-M3_055 [Citrobacter freundii]
MEAFNFGPTLTPQTLERFLVHCSNNEVSDILLQGGDKIWVERHGRQLPMTSYPLDNLELERTVDKVFGQE
IKGTLKSAAVVNTAIQLRGDEAGTIGLGRGETRRFRANFTQADIYKTEAAMSLTLRVLNEVIPQLKQMGI
EPDLFNSLLPAAGLGLICGETGSGKSTLMASIFQYCGETYQDRKIITVEDPIEYRLGSRDWIAPAPAQSQ
IGRDIDSFHNFITLSGLRRSPKIMGVGELLNRLSFEAAVLAGKSGHFCLGTLHVKTVGEAISRSLQNYPP
EMREAAAFDLLSILSYIIVQRLLKTKDGRRKAVREYLVIDNSLRRKLYDVDYSKWGRYIDDLLIAENRSL
IQNAWAMHQEGLIDEAEVIEVAGYMDYLALKEGKYGH
 
Nucleotide Sequence: 1164 bp     [Download]
>gi|54145488|ref|NC_004464.2|:35307-36470 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGGAAGCATTCAATTTTGGTCCAACGCTGACGCCCCAGACGCTGGAACGTTTTCTCGTACACTGCTCAA
ACAATGAAGTGTCCGATATTCTGTTGCAGGGCGGAGATAAAATCTGGGTAGAACGTCATGGGCGCCAGTT
GCCCATGACATCTTACCCGCTCGACAACCTGGAGCTGGAACGTACCGTTGATAAGGTGTTCGGTCAGGAG
ATCAAAGGGACGCTGAAAAGTGCTGCGGTCGTTAATACCGCTATCCAGCTAAGAGGTGATGAAGCGGGCA
CGATTGGACTCGGCCGCGGCGAAACCCGCCGGTTCCGCGCGAACTTTACTCAGGCCGATATTTATAAAAC
AGAAGCGGCAATGTCTCTGACACTCCGTGTTCTGAATGAGGTTATTCCTCAGCTTAAACAAATGGGTATT
GAGCCGGACCTGTTTAATTCTCTGTTGCCGGCTGCCGGCCTCGGACTGATATGCGGCGAGACGGGATCGG
GCAAGTCAACCTTGATGGCCAGCATATTCCAGTATTGCGGTGAAACGTACCAGGACCGGAAAATCATCAC
GGTTGAAGATCCCATCGAGTATCGCCTGGGAAGTCGAGACTGGATTGCGCCGGCGCCGGCACAGTCACAG
ATTGGGCGCGATATTGATTCCTTCCACAATTTTATCACTCTCTCCGGGCTCCGTCGTTCTCCGAAGATTA
TGGGGGTTGGTGAGCTCCTTAACCGCCTGTCATTTGAAGCTGCTGTACTGGCAGGTAAATCCGGCCACTT
TTGTCTTGGCACACTGCACGTCAAAACGGTCGGAGAAGCCATTTCCCGATCATTGCAGAACTATCCGCCG
GAAATGCGTGAAGCTGCCGCCTTTGACCTGCTGAGTATCCTTTCTTACATCATCGTGCAACGCTTGCTTA
AAACAAAAGACGGCCGGCGCAAGGCTGTCCGTGAATATCTCGTCATTGATAACAGCCTGCGCCGCAAACT
CTATGACGTTGATTACAGCAAGTGGGGCCGCTACATCGACGACCTGTTGATCGCTGAAAACCGCAGTCTG
ATTCAGAATGCCTGGGCAATGCACCAGGAAGGTTTGATCGACGAAGCGGAAGTCATCGAGGTCGCAGGAT
ATATGGACTATCTGGCGTTAAAAGAGGGCAAGTATGGACATTAA
 Primer design