SecReT4
Protein ID: 27383485
T4SS name [ID]Tra_I [179]
Gene symboltraK
Locus tagpCTX-M3_056
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]36460..36720 [+]
Producthypothetical protein
Component typeTraK_I
UniProt IDQ8GFS9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 86 a.a.     [Download]
>gi|27383485|ref|NP_775015.1| hypothetical protein pCTX-M3_056 [Citrobacter freundii]
MDINKWRYAGRPLTVFGVPVISFLVYFIWFPFPSVKTFVICTCVVLFYFLLAMMGYTLPVLYQVILRVIR
GKKLTGRPWWYRRSQR
 
Nucleotide Sequence: 261 bp     [Download]
>gi|54145488|ref|NC_004464.2|:36460-36720 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGGACATTAACAAATGGCGTTATGCCGGCCGGCCACTGACGGTTTTTGGTGTGCCTGTTATCTCGTTTC
TTGTGTACTTCATCTGGTTTCCGTTCCCGTCAGTAAAAACCTTTGTTATCTGCACCTGTGTGGTTCTCTT
TTACTTTCTGCTGGCCATGATGGGCTACACGTTACCGGTGCTGTACCAGGTCATTCTCCGGGTTATCCGC
GGGAAAAAACTTACCGGGCGGCCGTGGTGGTACCGGCGCTCTCAGCGATAA
 Primer design