SecReT4
Protein ID: 27383487
T4SS name [ID]Tra_I [179]
Gene symboltraL
Locus tagpCTX-M3_058
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]39923..40435 [+]
Producthypothetical protein
Component typeTraL_I
UniProt IDQ8GFS7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 170 a.a.     [Download]
>gi|27383487|ref|NP_775017.1| hypothetical protein pCTX-M3_058 [Citrobacter freundii]
MHQSQSQRLGHKTKTLLVAVGFSCISVSSFAATQTCAAYELAKAGADAAYKQEVERINNAAKSESSTSDS
LGQCLGSLSVSLKIPQFPSISDIIDKVKDEVCNTVKSKINEKWGSLTNTTLDPWSTISSRLPDTSGILPN
ASSKNVQLNNPAAASGSGEDANSDAFPFHL
 
Nucleotide Sequence: 513 bp     [Download]
>gi|54145488|ref|NC_004464.2|:39923-40435 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGCACCAGTCGCAAAGTCAGCGCCTCGGCCATAAAACAAAAACCCTACTCGTAGCAGTAGGGTTTTCCT
GCATTTCTGTGAGCTCATTTGCAGCCACACAGACCTGTGCAGCATACGAACTGGCAAAAGCTGGTGCTGA
TGCTGCCTATAAACAGGAGGTTGAACGGATTAACAACGCCGCTAAAAGTGAATCCAGTACATCTGATTCT
CTCGGACAGTGCCTGGGGTCGCTATCGGTATCACTAAAAATCCCTCAATTTCCGTCTATCAGCGACATCA
TTGATAAGGTGAAGGATGAGGTATGCAATACGGTTAAATCGAAGATAAATGAGAAGTGGGGGAGCCTGAC
TAATACAACGCTGGACCCGTGGTCAACGATTTCATCCCGACTGCCAGATACGTCAGGTATCCTGCCCAAC
GCATCTTCTAAGAATGTGCAATTAAACAATCCGGCAGCTGCGAGTGGAAGTGGTGAGGATGCAAACAGTG
ATGCATTCCCGTTCCATTTGTAA
 Primer design