SecReT4
Protein ID: 27383489
T4SS name [ID]Tra_I [179]
Gene symboltraM
Locus tagpCTX-M3_060
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]41029..41811 [+]
Producthypothetical protein
Component typeTraM_I
UniProt IDQ8GFS5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 5.9e-32, Aligned region: 109..216
Protein Sequence: 260 a.a.     [Download]
>gi|27383489|ref|NP_775019.1| hypothetical protein pCTX-M3_060 [Citrobacter freundii]
MYTSLFINDLRDFLTQTFEKRNSMKTQNGENIMDQTDSDQNSVVDDDSNALAPALAEESNRTVQEIVSKH
GLKVILIQTLIILVAIIIIGLQGYWLHQKKIKYIATNGGMITEVHPTDEPAYTAEEVMDFANRTMIKSLS
LNFVNYENQLTSVRGDFSAEGYVSFRKALSDSGLLKDISEKRLNVKLSTTPGTLITEGLIRGTKTYAWQY
RIPVTVQLVGQAQDYRPQPYDLMVQVRRVKEDEDPRGIQVAQAILKPRNY
 
Nucleotide Sequence: 783 bp     [Download]
>gi|54145488|ref|NC_004464.2|:41029-41811 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGTATACCTCATTGTTCATTAACGATCTGCGTGATTTTCTAACACAAACTTTTGAAAAGAGAAACTCTA
TGAAAACACAAAATGGTGAAAATATTATGGATCAAACTGACTCGGATCAAAACTCAGTCGTTGATGATGA
CAGCAACGCCCTTGCTCCAGCTCTGGCTGAAGAGAGTAACCGAACGGTACAAGAAATCGTATCGAAACAT
GGTTTAAAAGTAATTTTGATTCAAACGCTAATCATATTAGTCGCAATCATTATCATTGGTCTTCAGGGTT
ACTGGCTTCACCAGAAAAAAATCAAATATATTGCAACGAATGGGGGCATGATCACAGAAGTTCATCCAAC
CGATGAACCCGCTTACACGGCGGAAGAGGTGATGGACTTTGCCAACCGTACAATGATCAAATCGCTTTCA
CTGAACTTTGTGAATTACGAAAACCAATTAACCAGCGTCCGCGGCGATTTTAGCGCTGAAGGGTACGTTA
GTTTCCGTAAAGCGCTGTCCGATAGTGGGCTGCTGAAAGATATCAGTGAAAAACGTCTGAACGTAAAACT
TTCCACAACTCCTGGAACCCTGATCACGGAAGGTCTTATCCGTGGCACCAAAACCTATGCCTGGCAATAC
CGCATTCCGGTGACTGTTCAGCTTGTTGGGCAGGCTCAGGACTACAGACCGCAACCTTACGATTTGATGG
TTCAGGTACGCCGCGTCAAAGAAGACGAAGATCCACGGGGTATTCAAGTAGCACAGGCCATTCTCAAACC
CCGGAACTACTGA
 Primer design