SecReT4
Protein ID: 27383490
T4SS name [ID]Tra_I [179]
Gene symboltraN
Locus tagpCTX-M3_061
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]41820..42971 [+]
Producthypothetical protein
Component typeTraN_I
UniProt IDQ8GFS4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF3625 [PF12293], Evalue: 1.6e-94, Aligned region: 130..382
Protein Sequence: 383 a.a.     [Download]
>gi|27383490|ref|NP_775020.1| hypothetical protein pCTX-M3_061 [Citrobacter freundii]
MKIKLLTVLMAALFSANSVSAADAPTGNGAPQQTAPAVPGGDIAQWQQASSGLPVNQQSQVQQPPQQTAQ
EQGQQQAQGQQPQAQAQQRPTTALPPAPMPQIPPPQQQVTHVNPQTLEELPAPVLQQIQPITPGQVRSAR
SAMEDMSAAAKTSPLTPIPRISSQTVSLSAGASIPQVRVFPNQATTVTFSDATGHPWVLGAPPYNSSPCA
SGGELCVGYIPGSAVFTIQPTNAYASGNITVLLKGLATPVIINVKGAEPSVKSKTVDVDYRLDLRIPKRS
PDTPVYTATPEKKISLYDKQLQSVLDGIPPEDAQRLKLKNAPGSTKVWQIGDELYVRSNMQLQDEFEKTL
SAIDGTHVYVLPATPVLTFSVNGQARDVEVELN
 
Nucleotide Sequence: 1152 bp     [Download]
>gi|54145488|ref|NC_004464.2|:41820-42971 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGAAGATTAAACTGTTAACTGTACTTATGGCCGCACTGTTTTCGGCAAATTCTGTATCTGCAGCTGATG
CGCCGACTGGTAATGGAGCGCCGCAGCAAACGGCGCCAGCTGTGCCTGGTGGTGATATTGCTCAATGGCA
GCAGGCCAGTTCCGGGTTGCCCGTAAATCAGCAGTCACAGGTGCAACAGCCTCCACAGCAAACAGCACAG
GAACAAGGTCAGCAGCAGGCGCAAGGCCAACAACCACAGGCACAGGCCCAACAGCGGCCAACGACTGCAC
TGCCTCCTGCACCCATGCCGCAGATTCCTCCACCACAGCAGCAGGTTACTCATGTTAATCCGCAGACACT
GGAAGAGTTACCTGCACCTGTTCTGCAGCAGATCCAGCCTATTACCCCTGGTCAGGTGCGGTCGGCCCGC
AGCGCAATGGAAGATATGAGCGCGGCGGCCAAAACCTCACCATTAACGCCGATCCCACGAATTTCAAGCC
AGACGGTATCACTGTCAGCTGGCGCATCCATTCCGCAGGTACGGGTATTTCCAAACCAGGCAACGACAGT
GACGTTTTCAGATGCAACCGGACACCCCTGGGTATTAGGTGCCCCTCCATATAATTCGAGTCCCTGTGCT
TCAGGTGGTGAACTGTGTGTTGGCTATATTCCAGGATCGGCGGTATTCACAATCCAGCCGACCAATGCCT
ATGCCAGCGGGAACATCACAGTGCTTCTGAAGGGGCTGGCCACGCCGGTCATTATTAACGTGAAGGGGGC
AGAACCCTCCGTTAAATCAAAAACCGTTGATGTTGATTATCGTCTGGATCTCCGTATCCCGAAGCGCAGT
CCTGACACACCGGTTTATACCGCTACGCCTGAGAAAAAAATCTCACTGTATGACAAGCAGCTGCAGAGCG
TGCTCGATGGCATCCCGCCTGAAGATGCTCAGCGGTTGAAACTTAAAAACGCGCCAGGGAGTACCAAAGT
CTGGCAGATCGGTGATGAGCTCTACGTCAGAAGTAACATGCAGCTGCAGGATGAGTTTGAAAAAACGCTT
TCCGCTATCGATGGCACACATGTTTACGTGCTGCCGGCAACACCAGTGCTGACTTTTTCTGTTAATGGTC
AGGCGCGTGACGTTGAAGTTGAGCTGAATTAA
 Primer design