SecReT4
Protein ID: 27383491
T4SS name [ID]Tra_I [179]
Gene symboltraO
Locus tagpCTX-M3_062
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]42983..44332 [+]
ProductTraO
Component typeTraO_I
UniProt IDQ8GFS3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 449 a.a.     [Download]
>gi|27383491|ref|NP_775021.1| TraO [Citrobacter freundii]
MATDKGKETRKMMLYVGGAAAVVALLGGYWLFGSSDEPATGGSQVKAQGLEGKTGREKANDPQYNKLLNE
WNVDNSDKAALTGDSFISTLSASNPVAVDYGTKAPPPKYSWESSAKPSGDNSKANDAEQKERERQAKAVA
TLLQKIDQARTPVVTGVALATPLGAEGNDKNGGTFSGWTDSVYPQNKKPDAEKQQGAKNKAKDKGARLVS
AYTLVPAVMDTAMDSDDQNSIAIAHVPTGAQAGAKFYSGQNRLAGDGIRIHFTGMELNGVQCKVDAYGVA
SDSLRAAVSSNVNNRWFSRIILPAVANGLGRTGQLYADSNSQMIITDGGNAYRSTDTPDGKAVAGTIIGG
MGEQAGRVLADDAARLPIKQVTVDRNQLIGIQFVAPVYESDCGENLENASAEQAQQQATPTLSSVQPQQM
PQPPAPNYPQQNFPSYPGYGYGTNNPYYR
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|54145488|ref|NC_004464.2|:42983-44332 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGGCTACAGATAAAGGTAAAGAAACCAGAAAAATGATGCTCTACGTCGGTGGTGCTGCTGCAGTGGTGG
CGCTTCTGGGAGGGTACTGGTTGTTTGGCTCATCAGATGAGCCGGCAACGGGCGGGTCGCAGGTGAAAGC
CCAGGGGCTGGAAGGGAAAACTGGCAGGGAAAAAGCTAATGATCCCCAATACAACAAGCTGCTGAATGAG
TGGAATGTTGATAATTCAGATAAAGCGGCTCTCACAGGGGATAGCTTCATCTCCACGTTGTCAGCCAGTA
ATCCGGTGGCCGTTGATTACGGCACCAAAGCACCGCCACCAAAATATTCGTGGGAATCGTCAGCAAAGCC
GTCGGGCGATAACAGTAAGGCGAATGATGCTGAGCAGAAAGAGCGTGAGCGTCAGGCTAAAGCGGTGGCT
ACGTTACTGCAGAAAATAGACCAGGCCAGAACACCAGTTGTCACGGGTGTTGCTCTTGCAACCCCTCTGG
GAGCAGAAGGAAATGACAAGAACGGCGGTACCTTCTCAGGGTGGACCGATTCGGTCTATCCGCAGAACAA
AAAGCCGGATGCTGAAAAACAACAGGGGGCGAAGAATAAGGCCAAAGATAAAGGAGCCCGGCTTGTATCG
GCTTACACGCTTGTGCCGGCAGTAATGGATACGGCGATGGACAGTGACGATCAGAACAGTATTGCTATTG
CCCATGTTCCAACTGGAGCGCAGGCCGGCGCCAAATTCTATTCTGGCCAAAACCGTCTTGCCGGCGATGG
TATTCGAATTCACTTCACCGGCATGGAGCTGAACGGAGTGCAGTGTAAGGTCGATGCGTATGGCGTGGCT
TCCGACTCGTTGCGCGCGGCCGTTTCCTCAAATGTAAATAACCGCTGGTTCAGCCGTATTATTCTGCCGG
CTGTCGCTAACGGATTAGGCCGAACTGGTCAGCTCTATGCGGACAGCAATTCGCAGATGATTATCACTGA
CGGCGGGAACGCATATCGTTCAACTGATACACCTGATGGCAAAGCGGTAGCCGGTACCATTATTGGCGGG
ATGGGTGAGCAAGCAGGGCGTGTCCTGGCCGACGATGCAGCCCGCCTGCCGATTAAGCAGGTTACGGTTG
ACCGTAACCAACTCATAGGCATCCAGTTTGTCGCGCCAGTGTATGAAAGCGACTGTGGCGAGAATTTGGA
AAATGCTTCTGCAGAGCAGGCGCAGCAGCAAGCAACTCCGACACTATCTAGTGTGCAACCTCAGCAGATG
CCTCAGCCTCCGGCTCCTAATTACCCTCAGCAAAACTTTCCAAGCTACCCCGGCTACGGGTATGGCACCA
ATAACCCGTATTACCGTTAA
 Primer design