SecReT4
Protein ID: 27383492
T4SS name [ID]Tra_I [179]
Gene symboltraP
Locus tagpCTX-M3_063
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]44344..45048 [+]
Producthypothetical protein
Component typeTraP_I
UniProt IDQ8GFS2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 234 a.a.     [Download]
>gi|27383492|ref|NP_775022.1| hypothetical protein pCTX-M3_063 [Citrobacter freundii]
MNLFEDDNKKEAAPAQEPVSAKTAEKPKPTVTPAAKANKKPLKISDYAWIGGIAVIAILLLVWLFGGSDS
GTAPAAGNGTIQSSGQRQNVQAAPAGQDSGDFREQISGILLQQKERLDAIESTSKNGMMILSSQLQSANE
QIKNLNNQVQELKMKAAGYGPSFSNQSGTISGATSQALPLLRGFSINDLSGDLAWVKYKNQTYAVKVGSQ
LGGVTITGIDTENRIVTTSKGLIR
 
Nucleotide Sequence: 705 bp     [Download]
>gi|54145488|ref|NC_004464.2|:44344-45048 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGAATCTGTTTGAAGATGACAATAAAAAAGAAGCAGCTCCTGCCCAGGAACCGGTGTCTGCTAAGACTG
CTGAAAAGCCAAAACCGACAGTGACGCCAGCAGCAAAAGCAAACAAAAAGCCGCTTAAGATTAGTGACTA
TGCATGGATTGGTGGTATCGCTGTCATAGCTATCCTGCTTTTAGTCTGGTTGTTTGGGGGCTCCGATAGT
GGCACTGCGCCTGCGGCCGGGAATGGCACGATCCAGTCTTCAGGGCAACGTCAGAACGTACAGGCTGCCC
CTGCCGGGCAGGATTCTGGTGACTTCCGCGAGCAGATTTCCGGGATTTTGCTGCAGCAAAAGGAACGGCT
GGACGCGATAGAATCAACTTCTAAAAATGGAATGATGATCCTTTCCAGTCAGTTACAAAGCGCTAATGAG
CAAATCAAAAATCTGAACAATCAGGTTCAGGAACTGAAAATGAAAGCCGCTGGTTATGGGCCTTCATTTA
GTAATCAGAGTGGAACAATTTCGGGGGCAACGTCGCAGGCATTACCTTTGTTGAGAGGTTTTTCAATTAA
TGATTTATCTGGCGATCTTGCTTGGGTAAAATACAAAAACCAGACGTATGCTGTGAAGGTCGGTAGTCAA
CTTGGCGGAGTCACCATTACGGGTATCGATACTGAAAATAGAATCGTTACTACAAGTAAAGGCCTTATCC
GCTAA
 Primer design