SecReT4
Protein ID: 27383494
T4SS name [ID]Tra_I [179]
Gene symboltraR
Locus tagpCTX-M3_065
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]45619..46008 [+]
Producthypothetical protein
Component typeTraR_I
UniProt IDQ8GFS0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 129 a.a.     [Download]
>gi|27383494|ref|NP_775024.1| hypothetical protein pCTX-M3_065 [Citrobacter freundii]
MKIVKLIKDKALSASIAAYQLRGTVAKSLVVLPLALLSKEAAAETTVWEKINTFTEGLASTQPGLITGGK
VIGVVFFIVGLVSLFLKNKRGKDISGSFIFWSMVVGACLVGLTAWISSVGSTVGVDATL
 
Nucleotide Sequence: 390 bp     [Download]
>gi|54145488|ref|NC_004464.2|:45619-46008 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGAAAATTGTTAAGCTTATCAAAGACAAGGCATTATCTGCATCCATCGCAGCGTATCAGCTGCGCGGAA
CGGTGGCAAAATCGTTAGTGGTATTGCCGCTGGCATTACTGAGCAAAGAGGCTGCGGCTGAAACGACTGT
CTGGGAGAAAATCAATACCTTCACGGAAGGTCTTGCCAGTACCCAGCCTGGTCTGATTACCGGCGGTAAA
GTCATTGGTGTTGTGTTCTTTATTGTCGGGCTTGTTTCTCTTTTCCTTAAAAACAAACGCGGGAAAGATA
TCAGTGGCAGCTTCATCTTCTGGTCAATGGTTGTTGGTGCTTGCCTGGTCGGCCTGACCGCATGGATCTC
TTCTGTTGGTTCAACTGTTGGCGTTGACGCAACCCTGTAA
 Primer design