SecReT4
Protein ID: 27383497
T4SS name [ID]Tra_I [179]
Gene symboltraU
Locus tagpCTX-M3_068
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]46545..49595 [+]
Producthypothetical protein
Component typeTraU_I
UniProt IDQ8GFR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.9e-60, Aligned region: 490..888
Protein Sequence: 1016 a.a.     [Download]
>gi|27383497|ref|NP_775027.1| hypothetical protein pCTX-M3_068 [Citrobacter freundii]
MISFFEDVIEGISRNLTSNDSLKYCDLTTVVGLTSQDRVEHPEIRAPYILTTKNNDFLTVIEVQGAKSSF
DEKSFNDFIMHLSNSLSNSFINSGHKLSVVFERDFTKNQEELNNVYKPQVAAIERLQIDIKDLIADDAKK
IAAHYSRERAYIVLYTSKGMIAKDELKNEQAKAAGVLKDIPQTRFSQNPIEFQLEGLKITHDAMLWRLIG
MLQGDDESGMGLLVDVLDVKHAGAMMRQMLFRNSTSENWYPRTPFDQNLRIYGAPRKDNIDSVLPPRLNI
QIMEGELEEDGGLIYCDGKYYGSVALELPPLHPVKFKQLFNAINRKIPYRIKYDFIGGGKKALFWPSVII
SFLRFIPSLGNIARDMDYVRAQSETDPTAIMAINFATWGDTKDEAKRNLAALTKAIEGWGVSGVSKTYGN
PGSALIASVPGLTTATPGSLHYPPLSEGLRMLPFERPASPWHGKGNINFITLDGKLFPYQIASPLQEKFT
DVITGVPGSGKSVLANRLNLSSIYRADKKLPYLTIIDKGYSAKGIADLISAELPSEKRHQIASITLNNDE
SHCINICDTQLGSRYLTQFEEVFLKQMLNAFCIDPAIGQPPDAMSVGQIVSKVVSNVYKAKAHSSANLFK
YNDPVINEALKESGLDKELGEDWFERATWWEVVDKLFAKKYLHAATVAQRYAVPTIHDFIAELQTESFKN
QYADVKVNGSEPVVGFVARCFQAAAAEYAIFSGITVYDFSPETRIAILDMQNVLGDRTTPAGKLKSGIMY
LFARQMAVRNYYLPQSAETFIPALPEQYRAYHQARIRELSEEVKHTFYDECHNFAGIDFIQNALNTADLE
DRKFNVRTAFSSQYLSHMPSSVLKTMNSLFMMRLTEGDEEYLKQLEINIPADILRRFRQLPQGVYPDGSG
TAFLGIFKTKRGLICHILKNTLGPKLLWALNSSAKDRALRDVLYEELGTKKAREELANRFPMGSASSIID
EMVVNQGGERDSEEESQTMAMKLAKEIISDVRRGFR
 
Nucleotide Sequence: 3051 bp     [Download]
>gi|54145488|ref|NC_004464.2|:46545-49595 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGATTTCTTTCTTTGAGGATGTGATCGAAGGTATCTCACGCAATCTGACATCAAATGACTCGTTAAAAT
ACTGTGATTTGACAACGGTTGTAGGGCTTACGTCGCAGGATCGCGTTGAGCATCCTGAAATCAGGGCTCC
GTACATTCTGACCACTAAGAACAACGATTTTCTTACCGTTATTGAGGTTCAGGGCGCTAAATCATCGTTT
GACGAGAAGTCGTTTAATGACTTCATCATGCACCTATCAAACTCCTTGTCGAATTCCTTTATTAACAGCG
GCCATAAGTTGTCTGTGGTGTTCGAACGCGACTTTACCAAGAACCAGGAAGAGCTGAATAATGTTTATAA
ACCGCAGGTAGCAGCAATAGAGCGTCTGCAGATAGACATTAAAGACCTGATCGCCGATGACGCAAAAAAA
ATCGCCGCTCATTACAGCCGTGAACGCGCTTACATCGTGCTGTATACCTCGAAGGGGATGATTGCGAAGG
ATGAACTTAAAAACGAACAGGCAAAAGCTGCCGGCGTACTGAAGGATATCCCGCAGACGCGCTTCAGTCA
GAACCCAATCGAATTTCAGCTTGAAGGTTTGAAGATCACGCATGACGCGATGCTGTGGCGCCTGATTGGT
ATGCTTCAGGGGGATGATGAATCAGGAATGGGGCTTCTGGTTGATGTCCTCGATGTCAAACACGCTGGCG
CAATGATGCGTCAGATGCTGTTCCGGAATTCAACATCAGAAAACTGGTACCCTCGCACGCCGTTTGACCA
AAATCTGCGAATTTATGGCGCCCCACGGAAAGACAATATCGACTCCGTGCTGCCGCCGCGGCTGAATATC
CAGATCATGGAAGGGGAACTGGAAGAAGATGGTGGCCTGATTTACTGTGATGGTAAGTATTACGGCTCTG
TTGCCCTTGAGTTACCACCACTTCACCCTGTCAAATTTAAGCAGTTATTCAACGCGATTAACCGGAAAAT
CCCGTACCGGATAAAATATGACTTTATAGGCGGGGGCAAAAAAGCACTGTTCTGGCCATCAGTAATCATA
TCTTTCCTTCGTTTCATTCCCTCACTCGGTAATATCGCGCGTGATATGGATTATGTCCGGGCCCAGAGCG
AAACCGATCCAACGGCTATCATGGCCATCAACTTTGCCACCTGGGGCGACACTAAGGATGAAGCCAAACG
CAACCTGGCGGCTTTAACTAAGGCGATTGAAGGCTGGGGTGTATCAGGTGTGTCCAAGACATATGGCAAT
CCAGGTAGCGCACTGATTGCATCCGTTCCGGGGCTGACGACGGCCACACCTGGCTCATTGCATTATCCGC
CGTTGAGTGAAGGCTTGCGGATGTTACCTTTTGAACGTCCGGCCAGTCCCTGGCATGGTAAAGGCAATAT
CAACTTCATCACGCTCGATGGCAAGCTGTTCCCCTATCAAATCGCCAGTCCCCTGCAGGAGAAATTTACC
GATGTCATCACCGGTGTTCCTGGTTCCGGTAAAAGCGTGCTGGCCAACCGCCTTAACCTGAGTTCGATTT
ACCGGGCTGATAAAAAACTGCCTTATCTGACCATCATTGATAAGGGCTACAGTGCAAAAGGTATCGCCGA
TCTGATTAGCGCTGAGCTGCCGTCAGAGAAACGTCACCAGATTGCCAGTATCACCCTGAACAATGACGAA
TCGCACTGTATTAACATCTGCGATACGCAGTTAGGTTCAAGGTATCTGACGCAGTTTGAGGAAGTATTCT
TAAAGCAGATGCTTAACGCATTCTGTATTGATCCGGCAATTGGCCAGCCGCCAGATGCAATGAGCGTTGG
CCAAATCGTCAGTAAGGTTGTATCAAACGTATACAAAGCAAAAGCGCATTCAAGTGCTAACTTGTTTAAG
TATAACGACCCGGTGATTAATGAAGCTCTGAAAGAATCAGGTCTGGATAAAGAGCTTGGTGAAGACTGGT
TTGAAAGAGCTACATGGTGGGAAGTCGTTGATAAGCTGTTTGCCAAAAAATATCTTCATGCTGCGACGGT
TGCTCAGCGTTATGCTGTGCCAACCATTCACGATTTTATTGCTGAACTACAAACTGAATCATTTAAAAAC
CAATACGCTGACGTAAAAGTTAATGGGAGTGAGCCTGTAGTAGGCTTCGTTGCACGTTGCTTCCAGGCTG
CTGCAGCTGAGTATGCCATTTTCTCAGGGATAACGGTTTATGATTTCAGCCCGGAGACTCGCATTGCGAT
CCTGGACATGCAAAACGTCCTCGGTGACAGAACGACACCTGCAGGTAAGCTCAAGTCCGGCATTATGTAT
CTTTTTGCGCGCCAGATGGCTGTGCGTAACTACTACCTGCCTCAGTCCGCAGAAACCTTCATTCCTGCTT
TACCGGAGCAGTACAGGGCATATCACCAGGCGCGCATCAGGGAGCTTTCAGAAGAGGTTAAACATACCTT
TTATGATGAGTGTCATAACTTTGCCGGCATCGACTTTATTCAAAATGCGCTGAACACCGCTGACCTTGAA
GATCGTAAATTCAACGTCCGTACTGCCTTCTCGTCTCAGTATCTGAGCCATATGCCTTCGAGTGTGCTTA
AAACCATGAACAGCCTGTTTATGATGCGCCTGACGGAAGGGGATGAAGAGTATCTGAAGCAATTAGAGAT
CAACATCCCGGCCGATATCCTGCGTCGTTTCAGACAGCTTCCGCAAGGGGTTTATCCGGACGGAAGTGGT
ACTGCATTCCTCGGTATTTTTAAAACAAAACGTGGTCTTATTTGCCACATTCTGAAAAACACATTAGGAC
CAAAACTGCTTTGGGCTTTGAACTCATCTGCAAAAGATAGAGCGCTCAGAGATGTGCTTTATGAAGAGCT
GGGAACGAAAAAAGCAAGGGAAGAATTAGCAAATAGATTCCCTATGGGAAGTGCATCAAGTATCATTGAT
GAAATGGTGGTCAATCAGGGTGGTGAGCGTGATTCTGAAGAAGAATCACAAACTATGGCGATGAAGCTCG
CTAAAGAAATCATTTCTGATGTGAGAAGGGGATTCAGATGA
 Primer design