SecReT4
Protein ID: 27383498
T4SS name [ID]Tra_I [179]
Gene symboltraW
Locus tagpCTX-M3_069
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]49592..50800 [+]
Producthypothetical protein
Component typeTraW_I
UniProt IDQ8GFR6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 402 a.a.     [Download]
>gi|27383498|ref|NP_775028.1| hypothetical protein pCTX-M3_069 [Citrobacter freundii]
MIKIGKAKRSVMAVSILAFSVQSAFAYTVNVNSSIPISTQVMPALSTANGLLGNIQATLINIGTAISQQG
DRQAALMQQVAETNRQFEVEQKRNDRLLQAQDKYRVPDDICAQSIGGGAAGVSSAAAGGQRTLGSASSAK
DVKAIFEVPARATDVDASSTAEVHSQYCDSSDYAAFGGTSFCPSVSDMPRADTSLSSLLYGAGKEGKAPD
LTFTDEQTDAALRYMKNTALRSAGRQLSRGEVKGASGRIYLGMIQQYQALTDAAAQPQMEMIANSKPNPA
TDAALADARKVPEVESYFQATASNRAKQLNRMSAREFEEFEVGRRYSNPAYQATLTNKNTEDLMREQINI
ANLNNWLVLKTKQQLEKQNVLLGQILANDAYQTYKPMLAAQLESVNAGVSRK
 
Nucleotide Sequence: 1209 bp     [Download]
>gi|54145488|ref|NC_004464.2|:49592-50800 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGATAAAAATCGGAAAAGCAAAACGGTCAGTGATGGCCGTTTCAATTCTGGCCTTCAGCGTACAGTCAG
CATTTGCCTATACGGTCAACGTTAACAGCAGCATTCCCATCTCAACGCAGGTTATGCCGGCGTTGAGCAC
AGCTAATGGCCTGTTAGGTAATATCCAGGCCACGCTGATTAACATTGGTACGGCAATCAGCCAGCAGGGC
GATCGCCAGGCAGCATTAATGCAGCAGGTGGCTGAAACTAACCGACAGTTCGAAGTCGAGCAAAAACGTA
ATGACCGGCTGCTGCAGGCACAGGATAAGTACCGTGTTCCGGATGATATCTGTGCGCAGTCTATTGGCGG
TGGCGCCGCGGGGGTATCCTCTGCGGCCGCTGGCGGTCAGCGAACGCTGGGAAGCGCCAGTTCTGCGAAA
GATGTTAAGGCTATTTTTGAAGTGCCGGCACGCGCAACCGACGTGGATGCATCTTCAACGGCCGAAGTTC
ACAGCCAGTACTGCGACAGTTCGGATTATGCTGCATTTGGTGGGACTTCATTCTGCCCAAGTGTATCTGA
CATGCCGCGGGCAGATACGTCGCTGAGCTCGTTGCTTTATGGCGCCGGCAAAGAAGGCAAGGCACCTGAT
CTGACGTTTACAGATGAGCAGACAGATGCGGCGCTGCGCTATATGAAAAATACCGCGTTGCGCAGTGCTG
GTCGTCAGCTGAGTCGTGGGGAAGTTAAAGGCGCCAGCGGGCGAATTTACCTGGGCATGATTCAGCAATA
CCAGGCGCTCACCGACGCGGCCGCACAACCTCAGATGGAAATGATCGCCAACTCCAAACCGAACCCGGCC
ACTGATGCCGCGCTTGCAGATGCGCGCAAAGTGCCGGAAGTCGAATCCTATTTCCAGGCGACGGCCAGTA
ACAGGGCGAAACAGCTTAACCGTATGTCTGCCAGAGAGTTTGAGGAATTCGAAGTAGGTCGCCGTTACAG
CAACCCTGCTTACCAGGCGACGCTGACCAACAAGAACACCGAAGATTTGATGCGTGAGCAAATCAATATC
GCCAATCTGAACAACTGGTTAGTGCTGAAAACCAAACAGCAGCTGGAGAAACAAAATGTGCTGCTTGGCC
AGATCCTGGCGAACGACGCATATCAAACATACAAACCGATGCTGGCAGCACAGCTGGAGAGTGTGAACGC
GGGAGTATCCAGAAAATGA
 Primer design