SecReT4
Protein ID: 27383499
T4SS name [ID]Tra_I [179]
Gene symboltraX
Locus tagpCTX-M3_070
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]50797..51447 [+]
Producthypothetical protein
Component typeTraX_I
UniProt IDQ8GFR5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 216 a.a.     [Download]
>gi|27383499|ref|NP_775029.1| hypothetical protein pCTX-M3_070 [Citrobacter freundii]
MTDENKTGDKDTAKSGKLKKGLDVVTGVNDLPEGKAKRTIYYITGISDIYFIIASVKQTFSLLFQRASFV
KKQIKNLDGPPVDSDANQPFAEVMKRSNRPVSELLDKASLYKKYWLCCFFALVLILLFLTSGYARLLLNG
SPNMSLLRATLTCGVLFAAGIFTFIKALTCEFMGWQLRNQAHSDAEQGTLRYFLNDGGVRNTFNFSQAGQ
ERGPHE
 
Nucleotide Sequence: 651 bp     [Download]
>gi|54145488|ref|NC_004464.2|:50797-51447 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGACCGACGAAAATAAAACAGGGGATAAAGACACAGCCAAATCAGGGAAATTAAAAAAAGGCCTTGATG
TTGTAACAGGTGTCAATGACCTCCCGGAAGGGAAGGCTAAACGAACGATATATTATATTACTGGCATCAG
CGATATATATTTTATTATCGCGTCAGTAAAGCAAACATTCAGCCTGCTCTTTCAGCGGGCTTCATTCGTT
AAGAAGCAAATAAAAAACCTTGATGGTCCACCTGTTGATTCTGATGCAAATCAGCCGTTCGCCGAAGTTA
TGAAACGGAGCAATAGACCTGTATCAGAATTGTTGGATAAGGCCAGTTTATACAAGAAATACTGGCTTTG
TTGTTTTTTTGCATTAGTCCTCATTCTGCTTTTTTTAACGTCTGGTTATGCCAGATTGCTTCTAAATGGC
TCACCGAACATGAGCTTGTTAAGAGCAACTCTCACCTGTGGCGTCCTGTTTGCTGCTGGGATCTTTACTT
TCATTAAGGCTCTCACATGTGAGTTCATGGGGTGGCAGTTACGAAACCAGGCTCACTCTGATGCAGAGCA
AGGTACGTTACGTTATTTCCTTAATGATGGGGGAGTGCGTAATACATTTAATTTTTCGCAGGCTGGTCAA
GAGCGGGGGCCACATGAGTAA
 Primer design