SecReT4
Protein ID: 27383500
T4SS name [ID]Tra_I [179]
Gene symboltraY
Locus tagpCTX-M3_071
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]51440..53620 [+]
Producthypothetical protein
Component typeTraY_I
UniProt IDQ8GFR4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 726 a.a.     [Download]
>gi|27383500|ref|NP_775030.1| hypothetical protein pCTX-M3_071 [Citrobacter freundii]
MSKLKRLLLSLFVVASPSYSADLGIDGITEAAKRSGDLSRQMLHTVFGEVVNNPFSPSGDGLLNNVFFTV
NEVIAILALVYMGIISIKKLHQAGQLGSFIEGDGNNAFKIVKTTFGWLLLVPTVVGWSVAQLLFLWCGSI
IGVGSANVIADKTASELASGKAVYIAPVMPEMASVAKGMFETNLCALGVNQGIAQMEASGQHYENNARMQ
YQTGDSTYSISVNNGSAVCGTVSLPQRPAGWTSIFASGYADSVYSVQQQATDTLWGKMKTAAEQFNAAYM
AKMRSGDGELPDVESAIQTAARDYQLQVQHAANSAAGDDEIVQKMESDIKEKGWLYLGVYYHTLATANTE
MKDVANLKPVVSGMSNDGDIGSIDYFKGLFQAYHSQLKNSNYTPPLGTESNALARNIDQKSLENAATTGD
GTSLITKIFDFNVTNWLATSNYGTGDGYSDVTNPLLKMKAIGDYTLGVAEVGLASWTAINVAVKVSEGKS
LPGFAAGMMNKLTGIRDAIAGVLESVSFLVYPLFYSLFGIGLALSIWLPFIPMIYWFVAMADWLVTLMTG
VLASSLWAATHINIGQSNDERSTYGYVFLIDVMIRPMLMVMGFIFASLAIVALGTALNMMFKFAMEQVQS
DSFTGLLSSIGFLMLYARLCTGMVARVFALPARMPNYVINWIGQKMNDSVLGDMQNHVHDIFAAFGRGAK
NMNRNNPKQFNPDAGVDKSKDGIKGA
 
Nucleotide Sequence: 2181 bp     [Download]
>gi|54145488|ref|NC_004464.2|:51440-53620 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGAGTAAATTAAAAAGGTTGCTTCTATCTCTTTTCGTTGTGGCGTCGCCTTCATATTCAGCGGATTTGG
GGATTGATGGCATAACTGAAGCGGCTAAACGTTCAGGTGACCTATCGCGTCAAATGTTACATACCGTTTT
TGGTGAGGTAGTTAATAATCCGTTTAGCCCTTCCGGCGATGGCTTACTTAATAACGTTTTCTTCACTGTC
AACGAAGTTATCGCGATTCTTGCCCTTGTCTATATGGGGATAATCAGCATTAAGAAACTTCACCAGGCAG
GTCAGTTGGGAAGTTTCATTGAGGGTGATGGCAATAACGCATTCAAAATTGTTAAAACGACTTTTGGGTG
GTTGTTGCTTGTACCTACCGTTGTCGGTTGGTCTGTGGCGCAGCTGCTTTTTCTATGGTGCGGTTCAATC
ATTGGCGTAGGATCTGCCAATGTTATTGCAGATAAAACGGCTTCGGAATTAGCGAGTGGTAAAGCTGTCT
ATATAGCCCCTGTTATGCCAGAAATGGCGTCTGTTGCAAAAGGGATGTTTGAAACAAACCTTTGTGCTTT
GGGTGTAAATCAGGGGATTGCTCAAATGGAGGCTTCTGGCCAACATTATGAGAATAACGCCAGAATGCAA
TACCAAACAGGTGACAGCACATATTCTATATCTGTAAACAACGGCTCAGCTGTATGTGGGACCGTTTCGC
TGCCACAACGTCCAGCAGGATGGACTTCTATCTTCGCTAGCGGTTATGCGGATTCCGTCTACAGCGTTCA
GCAACAAGCAACGGACACGTTGTGGGGAAAAATGAAGACTGCTGCAGAGCAGTTTAATGCAGCATATATG
GCAAAAATGCGTTCCGGGGACGGTGAGCTGCCAGATGTTGAAAGCGCGATCCAGACTGCTGCGCGTGATT
ACCAGCTTCAGGTTCAACATGCTGCTAATTCAGCAGCCGGTGACGACGAAATTGTTCAAAAAATGGAGTC
GGATATCAAAGAGAAAGGGTGGCTATATCTTGGTGTGTACTATCACACATTAGCTACTGCGAATACCGAG
ATGAAAGATGTTGCTAACCTGAAGCCGGTAGTTTCAGGAATGAGTAACGATGGCGATATCGGCTCTATCG
ATTACTTTAAAGGCTTGTTCCAGGCTTACCATTCTCAACTGAAAAATAGTAATTATACGCCGCCTCTTGG
CACCGAATCTAACGCACTTGCAAGGAACATTGATCAAAAAAGCCTTGAAAATGCCGCCACAACTGGAGAC
GGAACGTCCCTTATTACAAAAATTTTCGACTTCAACGTTACAAACTGGCTTGCAACGAGTAACTACGGCA
CTGGTGATGGTTACAGTGACGTGACCAACCCTTTACTCAAAATGAAAGCTATCGGCGATTACACGTTAGG
TGTAGCTGAGGTTGGACTCGCCAGTTGGACCGCTATCAATGTTGCAGTGAAGGTTTCAGAAGGGAAGAGT
CTACCCGGTTTTGCTGCGGGAATGATGAACAAACTTACAGGGATTCGAGATGCTATTGCTGGCGTATTAG
AATCGGTTTCGTTCTTGGTTTACCCGCTGTTTTATAGCCTCTTTGGTATCGGTCTTGCACTATCTATCTG
GCTGCCGTTTATACCGATGATTTATTGGTTTGTTGCTATGGCAGATTGGCTGGTTACGCTTATGACAGGT
GTATTGGCGTCTTCCCTGTGGGCAGCTACCCATATCAACATTGGCCAGAGTAATGATGAGCGGAGTACAT
ATGGTTATGTGTTCCTTATCGATGTAATGATTCGGCCGATGCTCATGGTAATGGGGTTTATTTTTGCTTC
TCTGGCCATCGTAGCTTTGGGAACAGCGTTAAACATGATGTTTAAATTCGCTATGGAACAGGTCCAGTCT
GACTCTTTCACTGGCCTGCTGTCATCGATCGGATTTTTGATGTTATATGCAAGGCTTTGCACAGGTATGG
TGGCTCGCGTATTTGCACTTCCTGCGAGGATGCCGAACTATGTTATAAACTGGATTGGACAGAAGATGAA
CGATTCAGTGTTGGGTGATATGCAGAACCATGTTCATGACATCTTTGCTGCGTTCGGTCGTGGAGCCAAA
AATATGAACCGTAACAACCCTAAGCAATTTAATCCTGACGCAGGTGTAGATAAGAGCAAGGACGGCATCA
AAGGAGCTTAA
 Primer design