SecReT4
Protein ID: 27383527
T4SS name [ID]Tra_I [179]
Gene symboltrbC
Locus tagpCTX-M3_101
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]84148..86235 [-]
Producthypothetical protein
Component typeTrbC_I
UniProt IDQ8GFN9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.2e-05, Aligned region: 134..509
Protein Sequence: 695 a.a.     [Download]
>gi|27383527|ref|NP_775060.1| hypothetical protein pCTX-M3_101 [Citrobacter freundii]
MQQESVDSKKVIRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMHFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFADWLDGTDTDDVLYHQEDDLFPMIEM
 
Nucleotide Sequence: 2088 bp     [Download]
>gi|54145488|ref|NC_004464.2|:c86235-84148 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGCAACAGGAATCTGTAGACAGTAAAAAAGTCATCCGCCCAGATGGTTCGTTCATGGAGTGGTTCCTCA
CTCCGAACGTACAGTTTGGCCTGCTGGCCATACTGACCGTGCTGGGTCTGTTTCTCCCCTTTACCATGCT
GCTGAGCATCCTCATCCTTCCGCCGCTGATGGTGGCATTCACGGATCGTAAATTCCGGCCACCGCTGCGA
ATGCCGAAAGACTGCGAAATGTTCGACGACACCCTGACCACGGAAACCCAGGCGGAATACCGTCTGGGGC
CCATTCGCATCCCGCATAAGGTCCGGGAGCGAAAGAAAGCGAAGGGAATTTTATATGTCGGGTATGAGCG
GGGACGCCTGTTCGGCCGCGAGCTGTGGCTGAACATGACGGACCTGCTGCGCCACATGGTATTTTTTGGT
ACCACCGGGTCGGGTAAAACCGAAACCTTCTATGGGTTTATCGTTAACTTCCTGCTGTGGTGCCGTGGCT
ACTGCCTCTCAGACGGTAAAGCAGATAACAAGCTGGCCTTCGCCACCTGGTCGCTGGCGCGCCGTTTCGG
CCGTGAGGATGATTATTACGTCCTCAACCTGCTGACCGGCAGTATTGACAGGTTCGTGAACCTGGTGAAG
CAGGAAAGCATCCCCGCGCAATCCAACTCAGTCAACCTCTTCAGCGTTGCCCCGCCGACCTTCATCATCC
AGTTGATGGAATCCATGCTCCCCCAGGTGGGCGGAGATTCGGCACAGTGGCAGGATACGGCAAAAGCCAT
GATGTCGGCGCTGATCAATGCCCTGTGTTATAAGCGCGCCCGCGGCGAACTGCTTTTGTCACAGCGCACT
ATTCAGAAAAACATGTCGCTGCCGGCAATGGCCGCGCTGTACGTTGAGGCAAAGAAAAACGGCTGGCACA
GCGAGGGTTACGCCGCGCTGGAAAGTTATCTGGAAAATACACCAGGCTTCCTGCTGGCCAACGCGGAATA
CCCGGAAACGTGGGAAGCCCGCGCCTTCGAACAGCATAACTACATGAGCCGTCAGTTCCTGAAGACGCTC
TCCCTGTTCAATGAAACTTATGGCCATGTTTTTCCGGAAGACAGCGGCGATATCCGGATGGACGATATTT
TCCACAATGACCGCATTCTCATCGTCATGATCCCGTCGCTGGAGCTGTCACGCGGTGAAGCGGCCACGCT
TGGCCGTTTATATGTGACGCTGCAGCGAATGACCATCAGTAAGGACCTGGGCTACCAGCTGGAAGGGAAA
AAAGAGGAAGTCCTGCTCACTCACGCGCTGAATAATCAGGCGCCATACGGGCTGATTTATGACGAGCTGG
GCCAGTATTTCACCAGCGGTATGGATACGCTGAGTGCGCAGATGCGTTCACTGGAAAAAATGGGCGTATT
TTCCTCCCAGGATCACCCGTCGCTCGCCCGCGGCGCGAACGGCGAGGTGGATTCGCTGATCGCCAACACC
CGCGTGAAATATTTTGAGTCGATTGAAGACCGGAAAACCTTTGAAATACTGCGCGAAACCGTCGGCCAGG
ATTATTATTCAGAGCTCTCCGGGCAGGAAGCCGAACACGGCACGTTTTCCAAAACGGTCCGGGAAGGGGA
TCTGTACCAAATCCGTGAAAAGGACCGCGTGAACATTCGTGAGCTGCGTAAGCAGACCGAAGGTCAGGGG
GTAATTTCTTTCCAGGATGCCCTGGTACGCAGCGCAGCGTTTTACATTCCGGACAATGAGAAGTTTTCCA
GCGAACTGCCGATGCGGATAAACCGCTTTATCGAGGTATTACCGCCATCGCCGGCGACGCTGTACAGCAT
CTATCCGGAACGTAAGGATGATGAACTGGCGGAAACGAACCCGGATGCAATGCACTTCCCGCCGATCAAG
CTGTTCGGCTACGACAAAGCGGCCAACAGCCTGCTGGAAAAAATTGAGGTCTTCTACGAGCTGCAGTGTG
GCGCAATTTCACCGGAGGAAATGTCGGTGTGCCTGTTTGAACTGTTCGCTGACTGGCTTGATGGGACGGA
CACAGACGACGTGCTTTACCACCAGGAAGACGATCTGTTTCCGATGATCGAGATGTAA
 Primer design