SecReT4
Protein ID: 27383529
T4SS name [ID]Tra_I [179]
Gene symboltrbA
Locus tagpCTX-M3_103
StrainCitrobacter freundii plasmid pCTX-M3 (NC_004464)
Repliconplasmid pCTX-M3 [GenBank: NC_004464] [Browse all T4SS(s) in this replicon]
Location [Strand]87209..88516 [-]
Producthypothetical protein
Component typeTrbA_I
UniProt IDQ8GFN7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 435 a.a.     [Download]
>gi|27383529|ref|NP_775062.1| hypothetical protein pCTX-M3_103 [Citrobacter freundii]
MQNQPQRKGGGDDGLMIIGALLIMITVMWFGFRDYVIYGACRLLYWIYGVLPDAITPGNATERRDMLLSA
ARYNHQVSLWDFISVMNDTASVLFPLFILIIGLFVWVISRNPYYRLTRKLTIRNLPWVMVKNYPGIAHIL
ARFGHLDQLLLNEDPEEARSAQSPVEFAQEHNLIDTAKRRLRKKAAHKVFLSQVNLAPEGAALSLAPWEK
ALAASFVHLRFMGDRPTAKSILDDLNRSCLRTKDGFPDYSLAAGLWTVASQCEAFREFAKGRRSSRSLLY
ALFDDDLQLPSANFRWLKGVDRTLWYALSSAGRGKFFIEGGGVIAWSQCESYRLTLDEEKAAKFPPTVRA
AVLGLELDLLHYRHIDRRDPAIPVAHWQEDVIPPFAFESDAEAEDEPATPPAAPHDTPNNSLRLTDDEPT
PAKPQPATRPDHLEL
 
Nucleotide Sequence: 1308 bp     [Download]
>gi|54145488|ref|NC_004464.2|:c88516-87209 Citrobacter freundii plasmid pCTX-M3, complete sequence
ATGCAAAACCAGCCACAACGGAAAGGGGGAGGGGATGATGGCCTGATGATTATCGGGGCCCTTCTCATCA
TGATCACAGTGATGTGGTTTGGCTTTCGTGATTATGTGATTTACGGAGCCTGTCGCCTGCTTTACTGGAT
CTACGGTGTACTGCCGGACGCCATTACACCGGGTAATGCGACCGAGCGCCGGGACATGCTGCTGTCGGCG
GCGCGGTATAATCACCAGGTTTCGCTGTGGGACTTTATCAGCGTGATGAACGACACGGCCAGCGTGCTCT
TTCCCCTGTTCATTTTAATCATCGGGTTGTTCGTCTGGGTTATCTCGCGCAATCCTTACTACCGTCTGAC
CCGTAAACTGACCATCCGGAACCTGCCCTGGGTGATGGTAAAAAACTATCCGGGGATAGCCCATATCCTC
GCCCGGTTTGGCCACCTCGATCAGCTGCTGCTGAATGAAGATCCGGAAGAAGCACGCAGCGCGCAGTCAC
CCGTTGAGTTTGCCCAGGAACATAACCTGATTGATACCGCTAAACGCCGCCTCCGTAAAAAAGCCGCACA
TAAGGTATTCCTGTCACAGGTAAACCTGGCTCCCGAAGGGGCGGCCCTTTCCCTGGCACCCTGGGAAAAA
GCACTCGCAGCCTCGTTTGTACATCTGCGGTTTATGGGCGACCGGCCAACGGCTAAATCCATTCTCGACG
ATCTCAACCGTTCCTGCCTGCGGACTAAAGACGGCTTCCCTGATTATTCGCTGGCCGCCGGGCTCTGGAC
CGTCGCCAGCCAGTGCGAAGCGTTCAGAGAATTTGCAAAGGGGCGCCGCAGCTCCCGTTCGCTACTCTAC
GCGCTGTTCGATGATGACCTGCAGCTGCCATCCGCAAATTTCCGGTGGCTGAAAGGCGTGGACCGCACGT
TATGGTATGCACTTTCAAGCGCCGGCCGCGGGAAGTTCTTCATTGAAGGAGGTGGCGTTATTGCCTGGAG
TCAGTGCGAAAGTTACCGGCTGACGCTCGATGAAGAAAAGGCGGCGAAATTCCCGCCAACCGTGCGGGCG
GCCGTGCTGGGCCTTGAGCTGGATCTGCTCCATTACCGCCATATTGACCGCCGCGATCCCGCCATTCCGG
TCGCTCACTGGCAGGAAGACGTTATACCGCCATTTGCATTTGAATCTGACGCTGAAGCGGAAGACGAGCC
GGCTACGCCGCCTGCAGCTCCGCACGACACCCCGAACAACAGTCTGCGACTGACAGACGATGAACCGACG
CCGGCTAAACCTCAGCCGGCAACCCGTCCCGATCACCTGGAACTCTAA
 Primer design