SecReT4
Protein ID: 283488423
T4SS name [ID]VirB [414]
Gene symboltaxB
Locus tagROD_p2391
StrainCitrobacter rodentium ICC168
Repliconplasmid pCROD2 [GenBank: NC_013718] [Browse all T4SS(s) in this replicon]
Location [Strand]23508..25370 [-]
Productputative conjugal transfer coupling protein TaxB
Component typeVirD4
UniProt IDD2TVE1
KEGG IDcro:ROD_p2391
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.5e-94, Aligned region: 147..568
TraG-D_C [PF12696], Evalue: 1e-22, Aligned region: 422..541
TrwB_AAD_bind [PF10412], Evalue: 3.3e-15, Aligned region: 337..555
Protein Sequence: 620 a.a.     [Download]
>gi|283488423|ref|YP_003368539.1| putative conjugal transfer coupling protein TaxB [Citrobacter rodentium ICC168]
MKTFNKSQSVFIFAVMLVAAWFAGSFIFFVLYFSQIKNLKPLKAVFRSIDAYRMDIFTDSLTLSVVTTDI
RVLAFVALGAGFVVSLIIPVAALIKLNEKKDNIFGDARFATTNDIRESNSFTLDGDEKDGIIVGIKDKKI
IRYVGAAFSAMGAGTRAGKGAGIVITNLMKYWWSVIILDPKRECFNITSLIRKVILGHEVYKFDPFSPVT
HRFNPLYYVSMGTSEGFNQLENLALIIYPYKTDGADAGSYLNKTAGGVFKSYAVALWFMIKNDKAGLKTL
DIEPVFSMSKINQLFERAEPEHLLSFMNDIRSELRGKDKTLADIGVAGLKAFIEMEDKTKAQLKSNFLNG
LSPFANPNVANATDGNDFDLRQVRKKRMTIYFCISGDNARLAEKITNIFFQLAIQVNLEKMPTDDPEIKH
DCLFLLDEFPSIGAVDYIKSKSGLIAGYKLKLLIVYQVGSQLEEIYSYAGSKTLLASAPCKIVYSASDVK
DARELSEAMGTRTVTIGSKSKSRSRGGTSRSESESLIERPLVTTNELLTLKFSEEILAMKGENPIRCEKA
FYYLHEYFFGDFVKVAPELANIFPRKKGKLVMPPQKVFENEIVAKGYLAVKEVPDLDKAA
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|283488383|ref|NC_013718.1|:c25370-23508 Citrobacter rodentium ICC168 plasmid pCROD2, complete sequence
GTGAAAACTTTTAATAAGTCGCAATCTGTTTTTATATTTGCTGTTATGCTTGTTGCGGCATGGTTTGCAG
GTTCATTTATTTTCTTTGTGCTTTACTTCAGCCAGATAAAGAATCTGAAACCATTGAAGGCTGTGTTCAG
ATCCATTGATGCGTACAGGATGGATATTTTTACAGACAGCCTTACTTTATCTGTTGTGACTACGGATATC
AGAGTTTTAGCCTTTGTTGCACTTGGAGCAGGATTTGTCGTGTCTCTTATTATCCCTGTTGCGGCGTTAA
TAAAACTGAACGAGAAGAAAGATAATATTTTTGGTGATGCGCGATTTGCGACAACTAATGATATTCGTGA
GTCTAACAGTTTCACGCTTGACGGTGACGAAAAAGACGGGATTATCGTTGGTATAAAAGACAAGAAAATC
ATACGCTATGTGGGAGCAGCATTCAGTGCGATGGGAGCCGGAACAAGGGCTGGTAAAGGTGCAGGTATAG
TCATCACTAATCTTATGAAGTACTGGTGGAGTGTTATTATTCTCGATCCAAAAAGGGAGTGTTTTAATAT
CACCAGTCTTATCAGGAAGGTGATTTTAGGTCATGAGGTTTATAAATTTGATCCCTTTAGTCCGGTAACG
CACCGCTTTAACCCTTTGTATTATGTCAGCATGGGAACGAGTGAAGGTTTTAATCAGCTTGAAAATCTTG
CGTTGATTATTTACCCCTATAAGACAGATGGTGCGGATGCTGGTAGCTATCTTAATAAGACGGCGGGGGG
TGTTTTTAAATCTTATGCTGTCGCTTTATGGTTTATGATTAAGAATGATAAGGCTGGACTAAAAACGCTT
GATATTGAGCCTGTCTTCTCAATGTCTAAAATTAATCAGCTTTTTGAGCGTGCAGAACCCGAACATCTTC
TTTCATTCATGAATGATATTCGTTCAGAATTAAGGGGGAAAGACAAAACGCTTGCTGATATTGGTGTCGC
TGGCCTTAAGGCATTCATTGAGATGGAGGATAAAACAAAAGCACAACTCAAAAGCAACTTTCTTAATGGA
TTATCACCGTTTGCTAACCCCAATGTGGCAAATGCTACTGATGGAAATGATTTTGATTTGCGGCAGGTGC
GGAAAAAGCGGATGACAATTTATTTCTGTATTTCTGGTGATAATGCCAGGTTGGCTGAAAAAATAACAAA
TATTTTCTTTCAGCTTGCTATACAGGTGAATCTTGAAAAGATGCCAACGGATGATCCGGAAATAAAACAT
GACTGCCTTTTTCTACTGGATGAATTCCCGTCAATTGGTGCTGTAGATTACATCAAGAGTAAATCTGGAC
TCATTGCTGGTTACAAGCTGAAATTGTTGATTGTTTACCAGGTCGGCTCTCAGCTTGAGGAAATCTACAG
TTATGCAGGCAGTAAAACATTACTGGCAAGTGCACCCTGTAAAATCGTTTATTCCGCTTCTGATGTTAAA
GATGCGCGGGAGTTATCAGAAGCGATGGGAACACGAACAGTAACTATCGGTTCGAAAAGCAAAAGTCGTA
GTCGTGGAGGAACATCGAGATCTGAATCAGAAAGCCTTATTGAGCGTCCACTGGTAACAACAAATGAACT
ACTTACACTGAAATTTAGTGAAGAAATCCTGGCAATGAAGGGAGAAAACCCGATTCGTTGTGAAAAGGCA
TTCTACTATCTCCATGAGTATTTCTTTGGTGATTTTGTGAAGGTTGCTCCGGAACTTGCAAACATTTTCC
CCAGGAAGAAAGGAAAGCTGGTTATGCCTCCACAGAAAGTATTTGAAAATGAAATCGTCGCAAAAGGGTA
TCTGGCAGTAAAAGAAGTTCCTGATCTCGATAAAGCGGCATAA
 Primer design