SecReT4
Protein ID: 283488424
T4SS name [ID]VirB [414]
Gene symboltriJ
Locus tagROD_p2401
StrainCitrobacter rodentium ICC168
Repliconplasmid pCROD2 [GenBank: NC_013718] [Browse all T4SS(s) in this replicon]
Location [Strand]25357..26385 [-]
Productputative conjugal transfer protein TriJ
Component typeVirB11
UniProt IDD2TVE2
KEGG IDcro:ROD_p2401
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.8e-61, Aligned region: 20..322
Protein Sequence: 342 a.a.     [Download]
>gi|283488424|ref|YP_003368540.1| putative conjugal transfer protein TriJ [Citrobacter rodentium ICC168]
MSGVIPVSISNKSLDFYKNQVFQSFLDIEGLTEIAVNRPGEIWTEINGDWTFHNNDGVTFDFCKRFSQTL
ASFRGDEIGDTKPLLSATLESGERVQVVFPPACERNTISITIRKPSTRQITHKEYVANGFYDYVQSGKKH
RTYDDELLDLFRARNIAAFMELAVAAGKTIVFAGATGSGKTTYMKSLIDFIPLNTRLITIEDAEEIKFFI
HKNYVHLFYPSESGSDSGSIITAAKLIKSCLRMKPDRILLAEIKGGDAWDFVKVAGSGHSGSMTSIHAAS
AKDAIIQMVTKCYQNRECQNLPFDVLRKIIMDSIDIVVHVGRDGVVRHMSDIYYKGAECENF
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|283488383|ref|NC_013718.1|:c26385-25357 Citrobacter rodentium ICC168 plasmid pCROD2, complete sequence
ATGAGTGGCGTTATTCCTGTCAGCATTAGCAATAAATCGCTCGATTTTTATAAAAATCAAGTATTCCAGT
CTTTTCTTGATATTGAAGGGCTAACAGAAATTGCTGTCAACCGTCCTGGTGAAATCTGGACGGAAATTAA
TGGTGACTGGACATTCCATAATAATGACGGTGTGACCTTTGATTTTTGTAAACGGTTTTCTCAGACGCTG
GCATCATTTCGGGGAGATGAAATCGGCGATACCAAGCCATTACTTTCAGCAACACTGGAATCAGGAGAAC
GTGTACAGGTCGTTTTTCCTCCTGCATGTGAGAGAAATACTATTTCAATCACTATACGTAAACCATCGAC
ACGGCAGATAACGCATAAAGAATATGTGGCGAACGGTTTTTATGATTATGTCCAGTCAGGAAAAAAACAC
AGGACATACGATGATGAGCTTCTTGATTTATTCAGAGCGAGAAATATCGCTGCTTTTATGGAGCTTGCCG
TAGCAGCAGGGAAAACCATTGTATTTGCCGGAGCAACGGGTTCCGGTAAAACAACCTATATGAAGAGTCT
TATCGATTTCATACCATTGAATACGCGGCTGATTACGATTGAAGATGCGGAGGAAATCAAATTTTTTATT
CATAAAAATTATGTGCATCTTTTTTACCCTTCGGAATCCGGCAGTGATTCCGGCTCTATCATAACAGCAG
CGAAATTAATCAAATCCTGTTTGAGAATGAAACCTGACAGAATTTTACTGGCGGAAATTAAAGGTGGCGA
TGCCTGGGATTTTGTGAAAGTTGCTGGTTCTGGTCACAGTGGAAGCATGACGTCCATTCACGCGGCCTCG
GCAAAAGATGCCATCATTCAGATGGTGACAAAATGTTATCAGAACAGAGAATGTCAAAATCTTCCTTTTG
ATGTTCTTCGTAAAATCATTATGGACAGTATTGATATTGTTGTTCATGTAGGCAGGGATGGTGTTGTCAG
GCATATGAGCGACATCTATTACAAAGGGGCTGAATGTGAAAACTTTTAA
 Primer design