SecReT4
Protein ID: 283488427
T4SS name [ID]VirB [414]
Gene symboltriG
Locus tagROD_p2431
StrainCitrobacter rodentium ICC168
Repliconplasmid pCROD2 [GenBank: NC_013718] [Browse all T4SS(s) in this replicon]
Location [Strand]28403..29089 [-]
Productputative conjugal transfer protein TriG
Component typeVirB8
UniProt IDD2TVA8
KEGG IDcro:ROD_p2431
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.8e-53, Aligned region: 12..224
Protein Sequence: 228 a.a.     [Download]
>gi|283488427|ref|YP_003368543.1| putative conjugal transfer protein TriG [Citrobacter rodentium ICC168]
MSEKIEKKIETAKSFERQLYAENERSKKNAWRVAVAASLLSLCLGAAICVLVPLKEKELAIVAVGEKTGR
TELITQVKQEKILQSEALGRYFVNTYITLREGYNYPSLQYDYETVQLYSSNTVKDDYLRLYNSDMAPDKI
YHNNGSYVAVEVISNIISDATAPDKLASVRFKKTTRNFTTGQVSVSYWTARVTYRFEPEKSVKSSSRELN
PLGFTVTSYQTDREVRGE
 
Nucleotide Sequence: 687 bp     [Download]
>gi|283488383|ref|NC_013718.1|:c29089-28403 Citrobacter rodentium ICC168 plasmid pCROD2, complete sequence
ATGAGTGAAAAAATCGAAAAGAAGATTGAGACAGCTAAATCCTTCGAAAGACAACTCTATGCAGAAAATG
AACGGTCTAAGAAAAATGCATGGCGTGTTGCAGTGGCAGCATCATTACTGTCCTTATGTCTTGGGGCTGC
AATTTGTGTTCTTGTGCCATTAAAAGAAAAAGAGCTTGCTATTGTGGCTGTTGGCGAAAAAACAGGCCGT
ACAGAACTGATTACTCAGGTTAAACAGGAAAAGATCCTGCAATCTGAAGCGCTTGGGCGGTATTTTGTAA
ACACGTATATTACTTTACGTGAAGGTTATAATTATCCGTCTCTTCAGTATGATTATGAGACTGTACAGCT
ATATAGCTCGAATACAGTAAAGGACGATTATCTTCGTCTGTATAACAGCGATATGGCTCCTGATAAAATT
TATCATAATAACGGTTCTTACGTTGCGGTTGAGGTCATCTCCAATATTATTTCTGACGCAACCGCGCCAG
ATAAACTGGCCTCTGTGCGTTTTAAAAAAACGACGAGAAACTTCACGACCGGACAGGTTTCAGTTTCATA
CTGGACGGCTCGTGTGACATATCGTTTTGAACCAGAAAAGTCGGTTAAAAGTTCCAGTCGTGAGCTTAAT
CCTCTCGGTTTTACGGTAACCAGTTACCAGACAGATCGGGAAGTCAGGGGGGAATGA
 Primer design