SecReT4
Protein ID: 283826883
T4SS name [ID]Tra_F [84]
Gene symboltraL
Locus tagEG356c_063
StrainShigella sonnei plasmid pEG356 (NC_013727)
Repliconplasmid pEG356 [GenBank: NC_013727] [Browse all T4SS(s) in this replicon]
Location [Strand]35158..35469 [+]
Producttype IV conjugal transfer pilus assembly protein
Component typeTraL_F
UniProt IDD2U5U5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.8e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|283826883|ref|YP_003377754.1| type IV conjugal transfer pilus assembly protein [Shigella sonnei]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICVGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|283826834|ref|NC_013727.1|:35158-35469 Shigella sonnei plasmid pEG356 complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTGTTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design