SecReT4
Protein ID: 283826903
T4SS name [ID]Tra_F [84]
Gene symboltraF
Locus tagEG356c_084
StrainShigella sonnei plasmid pEG356 (NC_013727)
Repliconplasmid pEG356 [GenBank: NC_013727] [Browse all T4SS(s) in this replicon]
Location [Strand]49329..50105 [+]
Productconjugal transfer pilus assembly protein
Component typeTraF_F
UniProt IDD2U5W5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.7e-79, Aligned region: 34..248
Protein Sequence: 258 a.a.     [Download]
>gi|283826903|ref|YP_003377774.1| conjugal transfer pilus assembly protein [Shigella sonnei]
MMKEKMMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQ
TATKRALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAAD
QAQQRQAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQ
RLGVKYFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 777 bp     [Download]
>gi|283826834|ref|NC_013727.1|:49329-50105 Shigella sonnei plasmid pEG356 complete sequence
ATGATGAAAGAAAAAATGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCT
TTATTTTTCCGGCGTCAGGGAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAA
AGAAAATAAACCTGTACCTGCAGCCCCCCGTCAGGAGCCGGATATTATGCAGAAACTGGCCGCGCTGCAG
ACGGCAACAAAGCGGGCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTTAAATATTTCC
GGCTGCAGAATTACTGGACTCAGCAGGCCGGGCTTTTCACCATGAGTGCTAAAAAGGCCATGCTGGCACA
TCCCGAACTGGACTATAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCGGCAGAC
CAGGCGCAGCAGCGACAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGC
AGGACCCCATCGACGGGCAACTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTAT
TCCCGTTTCCGTGGATGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAG
CGCCTCGGTGTGAAATATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTAT
CATACGGCTTTATTTCACAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAA
TTTTTAA
 Primer design