SecReT4
Protein ID: 283826905
T4SS name [ID]Tra_F [84]
Gene symboltraQ
Locus tagEG356c_086
StrainShigella sonnei plasmid pEG356 (NC_013727)
Repliconplasmid pEG356 [GenBank: NC_013727] [Browse all T4SS(s) in this replicon]
Location [Strand]50582..50866 [+]
Productconjugal transfer pilin chaperone protein
Component typeTraQ_F
UniProt IDD2U5W7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 5.7e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|283826905|ref|YP_003377776.1| conjugal transfer pilin chaperone protein [Shigella sonnei]
MISKYRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|283826834|ref|NC_013727.1|:50582-50866 Shigella sonnei plasmid pEG356 complete sequence
ATGATAAGTAAATACAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design