SecReT4
Protein ID: 283826916
T4SS name [ID]Tra_F [84]
Gene symboltraX
Locus tagEG356c_097
StrainShigella sonnei plasmid pEG356 (NC_013727)
Repliconplasmid pEG356 [GenBank: NC_013727] [Browse all T4SS(s) in this replicon]
Location [Strand]66014..66760 [+]
Producttype IV conjugative transfer system pilin acetylase
Component typeTraX_F
UniProt IDD2U5X8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 6.4e-53, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|283826916|ref|YP_003377787.1| type IV conjugative transfer system pilin acetylase [Shigella sonnei]
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERLALLACLLAVIPALNLASSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|283826834|ref|NC_013727.1|:66014-66760 Shigella sonnei plasmid pEG356 complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGT
CGTTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCGCTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATTCTTCTGATGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCGGTCAGTTACCGACTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGCTTGCATGCCTGCT
GGCCGTTATTCCGGCACTTAACCTTGCCTCCAGTGATGCAGCGGCGGTGGCCGGTCTTGTAATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGG
TATTCTACGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGTTGTGA
 Primer design