SecReT4
Protein ID: 285017481
T4SS name [ID]VirB [216]
Gene symbol-
Locus tagXALc_0686
StrainXanthomonas albilineans GPE PC73
Repliconchromosome [GenBank: NC_013722] [Browse all T4SS(s) in this replicon]
Location [Strand]740196..740474 [+]
Producttype IV secretion system subunit VirD4
Component typeVirD4
UniProt IDD2UCE7
KEGG IDxal:XALc_0686
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 4.4e-26, Aligned region: 1..90
T4SS-DNA_transf [PF02534], Evalue: 8.7e-25, Aligned region: 1..89
TrwB_AAD_bind [PF10412], Evalue: 7.3e-20, Aligned region: 2..92
Protein Sequence: 92 a.a.     [Download]
>gi|285017481|ref|YP_003375192.1| type IV secretion system subunit VirD4 [Xanthomonas albilineans GPE PC73]
MFMLDEFTALGRVEIVPVAVGWVAGYGIRIVIVIQSIAQLESVYGADTARGLITNLGVRIVFTPREQRDA
EEYSKMLGETTVRRRQRTQSYG
 
Nucleotide Sequence: 279 bp     [Download]
>gi|285016821|ref|NC_013722.1|:740196-740474 Xanthomonas albilineans GPE PC73 chromosome, complete genome
ATGTTCATGCTCGACGAGTTCACGGCCTTGGGCCGGGTGGAGATCGTCCCGGTGGCCGTGGGCTGGGTCG
CTGGCTATGGCATCCGCATCGTGATCGTGATCCAGTCGATTGCGCAGTTGGAATCGGTCTATGGCGCCGA
CACAGCGCGCGGCTTGATCACCAATCTCGGCGTGCGGATCGTGTTTACTCCACGAGAACAGCGCGATGCC
GAGGAATATTCGAAGATGCTGGGCGAGACCACCGTGCGCCGTCGGCAGCGCACGCAGTCATACGGCTAG
 Primer design