SecReT4
Protein ID: 285017482
T4SS name [ID]VirB [216]
Gene symbol-
Locus tagXALc_0687
StrainXanthomonas albilineans GPE PC73
Repliconchromosome [GenBank: NC_013722] [Browse all T4SS(s) in this replicon]
Location [Strand]740520..740690 [+]
Producttype IV secretion system subunit VirD4
Component typeVirD4
UniProt IDD2UCE8
KEGG IDxal:XALc_0687
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-05, Aligned region: 1..44
Protein Sequence: 56 a.a.     [Download]
>gi|285017482|ref|YP_003375193.1| type IV secretion system subunit VirD4 [Xanthomonas albilineans GPE PC73]
MNPDEVKGLAPDKAIVFIEGIGYPILANKIFYYKDSYFKKLLLQAPQVPRLALGGE
 
Nucleotide Sequence: 171 bp     [Download]
>gi|285016821|ref|NC_013722.1|:740520-740690 Xanthomonas albilineans GPE PC73 chromosome, complete genome
ATGAATCCGGATGAGGTCAAGGGGCTGGCACCGGATAAAGCCATCGTGTTCATTGAGGGCATTGGCTATC
CGATCCTGGCGAACAAGATTTTTTACTACAAGGACAGCTACTTCAAGAAGCTGTTGCTGCAAGCACCGCA
GGTACCCCGGCTCGCGCTGGGCGGGGAGTAA
 Primer design