SecReT4
Protein ID: 285018609
T4SS name [ID]VirB [216]
Gene symbolvirB11
Locus tagXALc_1839
StrainXanthomonas albilineans GPE PC73
Repliconchromosome [GenBank: NC_013722] [Browse all T4SS(s) in this replicon]
Location [Strand]2161413..2162468 [-]
Productprotien
Component typeVirB11
UniProt IDD2UE03
KEGG IDxal:XALc_1839
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-62, Aligned region: 28..325
Protein Sequence: 351 a.a.     [Download]
>gi|285018609|ref|YP_003376320.1| protien [Xanthomonas albilineans GPE PC73]
MTFEESPTAQISTDFLDYQYSVLGILDYLNSPEVTEICINRPGELYLETLRGWQRMEIPSLTFERARQFC
TSVVNESNTGQRITDVDPVVSLTFPTGQRAQFVIPPACDAGKISITIRLPSKHTKTLEQYQQDGFFQEIL
EMQVGVSEQDLELLELRRQRDYAEFFKKAVLFKKNIVVAGATGSGKTTFMKSLVNHIPNEERLVTIEDAR
ELFITQPNAVHLLYSKGGQSTSNVTAKSCMEACLRMKPDRIILAELRGDESFYFIRNCASGHPGSITSCH
AGSIGQTWDQLALMVKASAEGSGLEFSVIKRLLMMTIDIVVHIKSHAGRRYITGIDFDPERTLSGGMSDF
H
 
Nucleotide Sequence: 1056 bp     [Download]
>gi|285016821|ref|NC_013722.1|:c2162468-2161413 Xanthomonas albilineans GPE PC73 chromosome, complete genome
GTGACTTTCGAAGAATCTCCGACCGCACAGATTTCGACGGATTTTCTGGATTACCAGTATTCGGTGCTGG
GAATCCTAGATTATCTCAATTCTCCAGAAGTGACGGAAATCTGCATCAACCGTCCTGGTGAGTTGTACCT
GGAGACGCTGCGTGGCTGGCAGCGAATGGAAATACCGTCGTTGACCTTCGAACGTGCGCGGCAGTTCTGC
ACTTCGGTGGTCAACGAGAGCAACACCGGTCAGCGCATCACCGATGTAGATCCAGTCGTGTCGCTGACCT
TCCCGACCGGGCAGCGTGCCCAGTTTGTCATTCCTCCCGCTTGTGATGCGGGGAAAATATCGATCACGAT
TCGTCTTCCGTCCAAGCATACCAAGACCTTAGAGCAGTATCAGCAAGACGGGTTTTTCCAGGAGATCCTG
GAAATGCAGGTAGGAGTCAGCGAACAGGATCTTGAGTTGCTTGAATTGAGGCGCCAGCGCGATTATGCCG
AGTTCTTCAAGAAAGCTGTCTTGTTCAAGAAGAACATTGTCGTCGCAGGTGCTACCGGTAGCGGCAAGAC
GACGTTCATGAAGTCGCTGGTTAATCACATTCCCAATGAAGAACGCCTGGTAACGATCGAGGATGCGCGC
GAACTGTTTATCACGCAACCAAATGCGGTACATTTGCTTTACTCGAAAGGTGGGCAAAGTACGAGTAATG
TGACGGCGAAGAGTTGCATGGAAGCCTGCCTGCGAATGAAGCCGGACCGCATTATTCTGGCTGAGTTGCG
TGGTGACGAATCGTTTTATTTCATCCGTAACTGCGCTTCAGGCCATCCTGGTTCCATCACCAGTTGCCAT
GCCGGTAGCATCGGGCAGACTTGGGATCAGTTGGCCCTGATGGTCAAGGCGTCGGCCGAAGGTTCGGGAT
TGGAGTTCTCGGTCATCAAACGCTTGCTGATGATGACCATCGACATTGTGGTGCATATCAAGTCGCATGC
TGGGCGGCGCTATATCACCGGTATCGATTTCGATCCGGAACGTACGCTCTCCGGCGGGATGAGTGATTTT
CATTGA
 Primer design